Details for Chinese cabbage Locus Brara.A03115

Position : A01 ( 5`- 26263942 .. 26266122 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03115

Protein [Map View]
MSYSRQSMGSGSRSTRGYEFGRTYVVRPKGKHQATIVWLHGLGDNGSSSSQLLESLPLPNIKWICPTAPSRPVSLLGGFP
CTAWFDVGEISEDLHDDIEGLDASAAHIANLLSTEPTDVKVGIGGFSMGAAIALYSTTCYALGRYGNGLPYTINLRATVG
LSGWLPGWRSLRSKIESSNEAARRAASIPVILAHGTSDDVVPYRFGETSAQALAMAGFRQVMFKQYEGLGHYTVPKEMNE
VVHWLASRLGLEGSR*

DNA
ATGAGCTACTCTCGTCAAAGCATGGGTTCTGGTAGTAGAAGTACAAGGGGATATGAGTTTGGAAGGACTTATGTTGTGAG
GCCTAAAGGAAAGCACCAAGCTACTATTGTTTGGTTGCACGGTCTTGGAGACAATGGCTCAAGCTCGTCTCAACTCTTAG
AGAGCCTGCCTCTTCCAAACATAAAATGGATTTGTCCAACTGCTCCCTCACGTCCTGTTTCGCTTCTGGGAGGCTTTCCT
TGCACTGCATGGTTTGACGTGGGAGAAATCTCTGAGGATCTTCACGATGATATTGAAGGCTTAGATGCTTCAGCTGCACA
TATTGCTAACCTCTTATCAACCGAACCAACAGATGTCAAAGTTGGGATAGGTGGTTTCAGCATGGGTGCAGCAATAGCAC
TCTACTCCACAACATGCTACGCTCTTGGACGTTATGGAAACGGACTTCCTTATACTATAAACCTACGCGCTACTGTAGGA
CTCAGTGGTTGGCTTCCTGGTTGGAGGAGCTTAAGGAGCAAGATAGAAAGTTCAAATGAAGCTGCAAGGCGTGCTGCATC
GATACCAGTTATACTTGCACATGGAACTTCGGATGATGTAGTTCCTTACAGATTTGGAGAAACATCTGCGCAGGCACTTG
CCATGGCTGGATTCCGACAAGTTATGTTCAAACAATATGAAGGGCTTGGTCACTATACAGTTCCGAAAGAAATGAATGAG
GTCGTTCACTGGCTCGCCTCAAGGCTTGGACTTGAGGGCTCACGCTAA