Details for Chinese cabbage Locus Brara.A03114

Position : A01 ( 5`- 26262937 .. 26264218 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03114

Protein [Map View]
MAAALSSRFLNTVRCNRLASVSSVYQNGMMRYSSSVPSDSDTHDDFKPTQKVPPGGSTDSLKELVENDVKENPVMLYMKG
VPEAPQCGFSSLAVRVLQQYNVPIGARNILEDPELKNAVKSFSHWPTFPQIFIKGEFIGGSDIILNMHKEGELEEKLKDV
SANHKSQ*

DNA
ATGGCGGCTGCTTTGTCGAGCAGGTTTCTCAACACCGTTCGTTGTAACAGATTGGCATCTGTGTCATCAGTCTATCAAAA
TGGGATGATGAGATACTCATCTTCAGTTCCCAGCGATTCAGACACACATGATGACTTCAAGCCTACACAGAAAGTTCCTC
CTGGTGGTTCCACTGACTCTCTAAAGGAACTCGTTGAGAATGATGTGAAGGAGAATCCTGTTATGCTCTACATGAAAGGA
GTCCCTGAAGCTCCTCAGTGTGGGTTTAGCTCGCTAGCTGTAAGAGTTCTCCAACAGTATAATGTTCCTATAGGTGCTAG
AAACATTCTTGAAGATCCAGAGTTGAAAAACGCTGTGAAATCATTCAGCCATTGGCCTACATTTCCACAGATCTTCATCA
AGGGAGAGTTTATTGGAGGCTCAGACATCATCCTCAACATGCACAAGGAAGGTGAACTGGAGGAGAAGCTTAAAGACGTC
TCTGCAAACCATAAGTCTCAGTAA