Details for Chinese cabbage Locus Brara.A03112

Position : A01 ( 5`- 26255327 .. 26256914 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03112

Protein [Map View]
MSRPGDWNCRSCTHLNFQRRDSCQRCGDSRLGAGGVGGLDFGDFGGRGMSAFGFTTGSDVRPGDWYCTVGNCGTHNFASR
STCFKCGTFKDESLGGGGGGGVGGPVMFDADVMRSRVSGNGGRSSWKSGDWICTRLGCNEHNFASRMECFRCNAPRDFSM
RTSF*

DNA
ATGAGCAGACCCGGAGACTGGAACTGTAGATCATGCACCCACCTCAACTTCCAGCGCCGTGATTCTTGCCAGCGATGCGG
TGACTCCCGTTTGGGTGCAGGTGGAGTCGGTGGCTTAGACTTTGGTGATTTCGGCGGCAGAGGTATGTCTGCTTTTGGAT
TCACCACGGGCTCCGACGTTCGTCCAGGTGACTGGTACTGTACAGTTGGAAACTGCGGGACACATAACTTTGCCAGCCGC
TCCACCTGCTTCAAATGCGGCACTTTCAAGGACGAATCCCTCGGTGGGGGCGGCGGCGGTGGCGTAGGCGGTCCGGTCAT
GTTTGACGCTGACGTTATGCGGTCTAGAGTCTCCGGCAACGGTGGCCGCTCCAGCTGGAAATCCGGTGACTGGATTTGCA
CCAGGCTTGGTTGCAATGAGCATAACTTTGCAAGCAGAATGGAGTGCTTCAGATGCAATGCACCAAGGGACTTCAGCATG
AGAACCTCTTTCTAA