Details for Chinese cabbage Locus Brara.A03109

Position : A01 ( 5`- 26243213 .. 26244719 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03109

Protein [Map View]
MGWIGETVDSIKSIKIRQLLTQAITLGMIVTSALIIWKALMCVTGTESPVVVVLSGSMEPGFKRGDILFLHMTKEPIRAG
EIVVFNVDGRDIPIVHRAIKVHERENTGHVDVLTKGDNNDVDDIGLYADGQFWLHRHHIMGRAVGFLPYVGWVTIIMSEK
PIIKYILIGALGLLVITSKD*

DNA
ATGGGTTGGATCGGAGAAACAGTAGACTCGATCAAATCAATCAAGATCCGTCAGCTTCTCACCCAGGCCATCACGCTCGG
TATGATCGTGACGTCTGCATTGATAATATGGAAGGCGTTGATGTGTGTGACTGGCACTGAGTCTCCTGTGGTGGTTGTTC
TCTCGGGAAGCATGGAACCTGGCTTTAAGAGAGGGGATATATTGTTCTTGCACATGACCAAAGAGCCTATTCGAGCAGGC
GAGATTGTTGTTTTCAATGTTGATGGTCGTGATATTCCCATTGTCCATCGTGCAATCAAAGTTCATGAGAGGGAAAACAC
TGGACATGTTGACGTTCTAACAAAAGGTGACAACAATGACGTGGATGACATCGGTCTCTATGCTGATGGACAGTTTTGGC
TTCATAGGCACCATATAATGGGCAGAGCTGTTGGGTTCTTGCCTTATGTTGGATGGGTCACTATTATCATGTCAGAGAAG
CCTATCATCAAGTATATACTCATTGGTGCATTGGGTTTGCTCGTTATAACATCCAAAGACTGA