Details for Chinese cabbage Locus Brara.A03108

Position : A01 ( 5`- 26234628 .. 26238405 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03108

Protein [Map View]
MAQHLLHGTLHATIYEVDALHTGGLSSGFLGKIRANVEEAIGFGKGETQLYATIDLQKARVGRTRKITDEPKNPKWYESF
HIYCAHMASDIIFTVKDDNPIGATLIGRAYVPVDEVINGEEVEKWVEILDNDRNPIHGESKIHVKLQYFGVETDRNWNMG
VKSAKFPGVPYTFFSQRQGCRVSLYQGAHVPDNFVPKIPLAGGKNYEPHRCWEDIFDAITNAKHLIYITGWSVYTEITLV
RDSRRPKPGGDMTLGELLKKKASEGVRVLLLVWDDRTSVDVLKKDGLMATHDEDTENYFNGSEVHCVLCPRNPDDGGSIV
QNLQVSAMFTHHQKIVVVDSEVPSQGGGGSEMRRIMSFVGGIDLCDGRYDTPFHSLFRTLDTVHHDDFHQPNFTGASITK
GGPREPWQDIHSRLEGPIAWDVLYNFEQRWSKQGGKDILVKLRELSDIIITPSPVMFQEDHDVWNVQLFRSIDGGAAAGF
PESPEVAAEAGLVSGKDNVIDRSIQDAYIHAIRRAKDFIYIENQYFLGSSFAWAADGITPEDINALHLIPKELSLKIVDK
IEKGEKFRVYVVVPMWPEGIPESASVQAILDWQRRTLEMMYKDVTQALRAQGLEEDPRNYLTLFCLGNREVKKEGEYEPA
ERPDPDTDYMRAQEARRFMIYVHSKMMIVDDEYIIVGSANINQRSMDGARDSEIAMGGYQPHHLSHRQPARGQVHGFRMS
LWYEHLGMLDETFLDPSSLECIEKVNRIADKYWDFYSSESLEHDLPGHLLRYPISVDNEGNISELPGFEFFPDTKARILG
NKVDYLPPILTT*

DNA
ATGGCGCAGCATCTGTTGCACGGGACTTTGCACGCTACCATCTATGAAGTTGATGCTCTCCACACTGGTGGTCTCAGCTC
TGGCTTCCTCGGCAAGATTAGAGCAAATGTTGAAGAGGCAATTGGTTTCGGCAAAGGAGAAACACAGCTCTACGCAACTA
TCGATCTACAAAAAGCTAGAGTTGGTAGAACCAGGAAGATCACAGACGAGCCCAAGAACCCAAAGTGGTACGAGTCCTTC
CACATCTACTGTGCCCACATGGCTTCAGACATCATCTTCACCGTCAAAGATGATAACCCCATAGGAGCCACCCTCATCGG
TAGAGCGTACGTCCCCGTCGACGAAGTCATCAACGGCGAGGAAGTTGAAAAATGGGTTGAGATCTTGGACAACGACAGGA
ACCCTATCCACGGAGAGTCCAAGATTCACGTCAAACTCCAGTACTTCGGCGTTGAGACGGATCGAAACTGGAACATGGGG
GTTAAAAGCGCGAAGTTCCCTGGAGTGCCTTACACGTTCTTCTCCCAGAGACAGGGCTGCAGAGTTTCTTTGTATCAAGG
CGCTCATGTTCCGGATAACTTCGTCCCCAAGATTCCTCTCGCTGGTGGGAAGAACTACGAGCCTCACAGATGCTGGGAGG
ATATTTTCGACGCGATAACAAATGCAAAACATTTGATCTACATCACAGGATGGTCTGTTTACACTGAGATCACTTTGGTG
AGAGACTCGAGGAGGCCTAAACCAGGAGGTGATATGACTCTTGGTGAGTTACTTAAAAAGAAAGCTAGCGAAGGCGTTAG
GGTTCTGTTACTTGTGTGGGACGACAGAACATCCGTTGATGTTTTAAAAAAAGACGGTCTCATGGCTACTCACGATGAAG
ACACTGAGAACTACTTCAACGGAAGCGAAGTGCATTGTGTGTTGTGTCCACGTAACCCTGATGATGGCGGTAGCATAGTC
CAAAACTTGCAAGTCTCAGCCATGTTCACGCACCACCAGAAGATCGTAGTTGTGGACAGCGAGGTGCCGAGCCAAGGAGG
AGGAGGGTCGGAGATGAGGAGGATCATGAGTTTTGTCGGAGGTATTGATCTATGCGATGGACGTTACGACACTCCTTTCC
ACTCCTTGTTCAGGACGTTGGACACGGTGCACCACGATGACTTCCATCAGCCTAACTTCACCGGTGCTTCGATCACCAAA
GGTGGTCCTAGGGAGCCTTGGCAGGACATCCACTCTCGTCTCGAAGGTCCAATCGCTTGGGATGTGTTGTACAACTTCGA
GCAGAGATGGAGCAAGCAAGGTGGTAAAGACATTCTCGTTAAGTTGAGAGAGCTTAGTGACATTATCATCACTCCTTCTC
CTGTTATGTTCCAAGAAGATCACGACGTGTGGAATGTGCAGCTCTTTAGATCTATAGACGGTGGAGCTGCCGCTGGGTTC
CCTGAATCACCTGAAGTAGCTGCTGAAGCTGGTTTGGTAAGTGGTAAGGACAATGTCATTGACAGGAGTATCCAAGACGC
TTACATTCACGCCATAAGACGTGCTAAAGACTTCATCTATATCGAGAACCAGTACTTCCTTGGAAGCTCCTTTGCTTGGG
CTGCTGATGGTATCACTCCTGAGGACATCAATGCACTGCATCTGATCCCAAAGGAGTTGTCTCTCAAGATCGTTGACAAG
ATTGAGAAAGGAGAGAAGTTTAGAGTCTACGTTGTGGTTCCGATGTGGCCTGAAGGTATCCCGGAGAGTGCATCGGTGCA
AGCTATATTGGATTGGCAGAGGAGGACCTTGGAGATGATGTACAAGGATGTTACTCAGGCTCTCAGGGCTCAGGGGTTGG
AGGAAGATCCTAGGAACTATCTGACGTTATTCTGCCTTGGGAACCGTGAGGTTAAGAAAGAAGGGGAGTATGAGCCTGCG
GAGAGACCAGACCCTGACACTGACTATATGAGGGCGCAAGAAGCACGTCGCTTCATGATCTACGTCCATAGCAAAATGAT
GATCGTTGATGATGAGTACATTATCGTTGGATCTGCTAACATCAACCAGAGGTCAATGGATGGTGCAAGGGACTCTGAGA
TAGCAATGGGAGGGTATCAACCACATCACTTGTCACATAGACAACCAGCTCGTGGCCAGGTCCATGGATTCCGTATGTCA
CTCTGGTACGAACACTTGGGAATGCTTGATGAGACCTTCCTAGATCCCTCAAGCTTGGAATGCATTGAGAAAGTTAACCG
TATTGCTGATAAGTACTGGGACTTTTACTCAAGTGAGTCACTGGAACATGACCTTCCTGGTCACTTGCTGCGCTACCCGA
TTAGTGTGGACAATGAAGGTAACATCTCTGAGCTTCCAGGATTTGAGTTCTTCCCAGACACAAAGGCTCGTATCCTCGGA
AACAAAGTAGACTACCTGCCTCCAATCCTTACAACTTAA