Details for Chinese cabbage Locus Brara.A03107

Position : A01 ( 5`- 26232999 .. 26233914 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03107

Protein [Map View]
MSYMLGCSNGTVAIATAMVFSSTALFLATARQFYGNQTSQVRDQTPPPPLLRSCLSSSEAMKKHRSKKKKVRFAKNVKDT
KGNGKEYRKRRELSRRIVHESVTQPGKTGSVCGISTMPANRMALYNGILRDRSHRTQCSY*

DNA
ATGTCTTATATGTTGGGTTGTTCTAATGGCACCGTGGCGATCGCAACGGCCATGGTTTTCTCAAGCACTGCTCTGTTTCT
AGCGACGGCTCGTCAATTCTATGGGAATCAAACCTCGCAGGTTCGTGATCAGACTCCACCACCACCACTCCTCCGTTCTT
GTCTATCTTCTTCAGAGGCAATGAAGAAACATAGGAGTAAGAAGAAGAAAGTTAGGTTCGCGAAGAATGTGAAAGATACC
AAAGGGAACGGGAAAGAGTACCGGAAGAGGAGGGAGTTGAGTCGGAGAATAGTACATGAGTCAGTGACTCAACCGGGGAA
AACCGGTTCGGTTTGTGGAATATCCACGATGCCAGCGAACCGGATGGCTCTGTACAATGGGATTCTCAGAGACCGATCTC
ACAGAACTCAATGTTCTTATTGA