Details for Chinese cabbage Locus Brara.A03105

Position : A01 ( 5`- 26229269 .. 26230791 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03105

Protein [Map View]
MGTEEESVSVELPAPSSWKKLFFPNKVGSVKKTEIVFVAPTGEEISNRKQLDQYLKSHPGNPSITEFDWTTSGTPRRSAR
ISDKKTKSTPSPDKEPPKKRGRTKSSGSKKDAEEEGEKPEDTEMSPLKGTEESVTVKDGSGETKDDMVAEETPDPAPVQE
AGGESMKEQTHDLVGDTSKESVESQTNKEEATEIKTAEANTEQKKEDAGQGAPESEPEAETKSHEGNGLTAEAEGKEKAA
E*

DNA
ATGGGTACAGAAGAGGAAAGTGTATCTGTGGAGCTACCAGCACCTTCTTCATGGAAAAAACTGTTTTTTCCAAACAAAGT
GGGATCAGTGAAGAAAACAGAGATTGTGTTTGTTGCTCCAACGGGTGAAGAGATCAGTAACAGGAAGCAGCTGGACCAGT
ACCTCAAATCTCACCCTGGAAACCCTTCAATCACTGAGTTTGATTGGACCACCAGTGGGACTCCTAGGAGATCTGCAAGG
ATCAGTGATAAGAAGACTAAGTCGACTCCCTCACCAGATAAAGAGCCGCCTAAGAAGCGAGGTAGAACTAAATCTTCAGG
ATCAAAGAAAGATGCAGAAGAAGAAGGTGAGAAACCAGAGGATACTGAAATGTCTCCTCTTAAGGGAACGGAGGAGAGTG
TAACTGTTAAGGATGGCTCTGGTGAAACAAAAGACGACATGGTTGCAGAGGAGACTCCTGATCCTGCTCCGGTTCAAGAA
GCTGGTGGTGAGTCGATGAAGGAGCAAACACATGATCTAGTTGGTGATACTAGTAAGGAGAGTGTGGAGTCTCAAACTAA
CAAAGAAGAGGCAACTGAGATCAAGACTGCTGAAGCTAACACTGAGCAGAAGAAGGAAGATGCGGGCCAAGGCGCACCTG
AGTCTGAGCCTGAAGCTGAGACCAAAAGCCACGAGGGAAATGGCCTGACAGCAGAAGCTGAGGGGAAAGAGAAAGCTGCT
GAGTAA