Details for Chinese cabbage Locus Brara.A03100

Position : A01 ( 5`- 26192503 .. 26193003 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03100

Protein [Map View]
MDVNKNIVKVLARWCLLLQAIMISSNTVALKEPDYVNMNVTIRNAMTGLIRPEIVYRCQSKRKDYGWHRSKKPGMQFSFP
IILIKGESKIPAIHICNVRSVLGTATLVIENTYLDAEMCPKSSCAHVATPKGIVFRGLEWDFKTVFPKLKPVEYLELPWT
PWPNRT*

DNA
ATGGATGTCAACAAGAACATCGTCAAAGTCCTAGCTCGATGGTGCCTTCTCCTACAAGCAATAATGATCTCTTCCAACAC
CGTGGCTCTCAAGGAACCAGACTACGTAAACATGAACGTAACAATCCGTAACGCAATGACAGGGCTAATCCGACCGGAGA
TCGTCTACCGATGCCAGTCCAAACGTAAAGACTACGGTTGGCATCGATCTAAAAAACCAGGGATGCAGTTTTCATTCCCG
ATCATTCTCATAAAAGGTGAAAGCAAGATACCTGCTATTCACATCTGCAATGTCCGGTCAGTCCTAGGAACCGCCACACT
CGTGATCGAAAACACTTATCTCGATGCAGAGATGTGTCCTAAATCTTCATGTGCTCACGTAGCTACACCTAAGGGGATCG
TGTTTAGAGGCCTTGAATGGGATTTCAAAACCGTGTTTCCTAAACTCAAACCAGTTGAGTATCTAGAGTTGCCCTGGACA
CCTTGGCCTAACAGAACATGA