Details for Chinese cabbage Locus Brara.A03099

Position : A01 ( 5`- 26185682 .. 26192031 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03099

Protein [Map View]
MSSLSRELVFLILQFLDEEKFKDTVHRLEKESGFFFNMRYFEDCISAGEWDDVEKYLSGFTKADDNRYSMKIFFEIRKQK
YLEALDKKDHAKAVEILAKELKVFSTFNEELFKEITMLLTLTNFRENEQLSKYGDTKSARGIMLGELKKLIEANPLFRDK
LQFPTLKNSRLRTLINQSLNWQHQLCKNPRPNPDIKTLFVDHSCGHPNGSHVPSPVTNHLMGSVPKVGGFPPLGAHGPFQ
PTPAPLTTSLAGWMPNPSISHPTVSAGPIGLGAPNSSVSMLKRPRTPPTNSLSMDYQTADSESVLKRPRPFGISDGVNNH
PVNVLPVTYPGQNHAHAAYSTDDLPKTVSRVLSQGSAIKSMDFHPVQQTMLLVGTNLGDIAIWEVGSRDKLASRSFKVWD
LATCTGNLQASLASEYTAAVNRVIWSPDGGLLGVAYSKHIVHIYSYHGGDDLRNHLEIDAHAGNVNDLAFSQPNQELCVV
TCGEDKTIKVWSAVTGNKLHTFEGHEAPVYSVCPHQKENIQFIFSTAVDGRIKAWLYDNMGSRVDYDAPGRSCTSMAYSA
DGTRLFSCGTSKEGESFIVEWNESEGAVKRTYLGLGKRSVGVVQFDTLKNKFLVAGDEFHVKFWDMDSVELLTTTTADGG
LPSSPCLRINKEGTLLAVSTTENGIKILANAEGSRILHSMANRGVESSRAPPGSVSKGPIVGTFGTPSSSTGMSLSMAER
SGPGAAVTAMNGDTRSLSDVKPRIPDEAERSKVWKLAEISERSQLRTLRLPDTLLPGRIVKLIYTNSGGAILALAENALH
KLWKWQKSERNLSGKANSNVPPQLWQPPNGVLMTNDTREGNKEDVVPCFALSKNDSYVMSASGGKISLFNMMTFKTMTTF
MAPPPAATSLAFHPQDNNIIAIGMDDSSIQIYNVRVDEVKSKLKGHQKRVTGLAFSNVLNVLVSSGADSQLCVWSMDGWE
KQASKQIQIPSGHSPNPLAHTRVQFHQDQTHVLVVHASQLAIYEAPKLENVKQWIPTESSGSVTDAVYSCDSQSIYAAFD
DGSVSILTATTLQLKCRIGPSSYLPSNPSLRLYPATIAAHPSEPNQFAVGLTDGGVHVIEPPGPEGKWGMSPPPENGAGP
SVSSAPGSDQQPR*

DNA
ATGTCGTCTCTCAGCAGAGAACTCGTCTTCTTGATTCTCCAGTTTCTCGACGAGGAGAAGTTCAAAGACACTGTTCACAG
GTTGGAGAAGGAGTCTGGGTTTTTCTTCAACATGAGGTACTTTGAAGACTGTATAAGCGCAGGTGAATGGGACGATGTGG
AGAAGTACCTTTCTGGATTCACTAAAGCTGATGATAATAGATACTCCATGAAGATCTTTTTCGAGATTCGTAAGCAGAAG
TACCTTGAGGCACTTGACAAGAAAGATCATGCCAAGGCAGTTGAGATCCTTGCTAAGGAGTTAAAAGTGTTCTCCACATT
CAATGAAGAGCTTTTCAAGGAGATCACCATGCTTTTAACCTTAACTAACTTCAGGGAAAATGAGCAGCTCTCCAAGTATG
GGGATACTAAGTCTGCAAGAGGTATTATGCTTGGGGAACTCAAGAAACTGATTGAGGCAAATCCTCTCTTCCGTGACAAA
CTCCAGTTTCCAACTTTGAAGAATTCAAGATTGAGAACCTTAATTAATCAAAGTTTAAACTGGCAGCATCAGCTTTGCAA
GAATCCAAGGCCTAACCCGGATATAAAAACACTCTTTGTTGATCATTCTTGTGGGCACCCTAATGGTTCTCATGTTCCTT
CCCCTGTAACTAATCATCTGATGGGCTCAGTCCCTAAAGTTGGAGGCTTCCCACCACTGGGTGCTCATGGTCCGTTTCAG
CCAACACCAGCTCCTCTTACAACATCTCTTGCAGGATGGATGCCTAATCCATCTATATCACATCCCACTGTTTCTGCTGG
TCCTATTGGCCTTGGTGCTCCCAACAGTTCTGTGTCTATGCTAAAGCGTCCCAGGACTCCTCCAACTAATAGCCTATCAA
TGGATTATCAAACAGCAGATTCTGAAAGTGTATTGAAGAGACCCAGACCCTTTGGTATATCAGACGGGGTTAATAATCAT
CCAGTCAATGTCTTGCCAGTCACATATCCTGGTCAAAACCATGCTCATGCAGCCTATTCTACTGATGACTTACCCAAAAC
TGTTAGCAGGGTTTTGAGTCAGGGTTCTGCTATCAAGAGCATGGATTTTCATCCAGTACAACAAACGATGCTTCTTGTTG
GCACCAATCTTGGTGATATTGCAATATGGGAGGTGGGCAGCAGGGACAAGCTTGCTTCTAGAAGCTTTAAAGTTTGGGAT
CTAGCTACCTGCACTGGGAATCTTCAGGCTTCACTTGCTAGCGAGTATACTGCAGCAGTTAACCGAGTCATCTGGAGCCC
TGATGGAGGCCTTCTGGGTGTCGCATATTCTAAGCATATTGTGCATATCTATTCATATCATGGTGGCGATGATTTGCGGA
ATCATCTAGAGATTGATGCTCATGCTGGCAATGTCAACGATCTTGCTTTCTCCCAACCAAACCAGGAATTGTGTGTTGTG
ACTTGTGGAGAAGACAAGACAATCAAGGTCTGGAGCGCTGTTACTGGAAACAAATTGCACACATTCGAAGGCCATGAGGC
ACCTGTTTATTCCGTGTGCCCACACCAGAAAGAGAATATTCAGTTCATATTCTCAACTGCTGTTGATGGAAGGATAAAAG
CTTGGTTATATGACAACATGGGTTCTAGAGTGGATTATGATGCCCCCGGTCGATCTTGCACATCAATGGCCTATTCTGCT
GATGGAACTAGATTATTCTCTTGTGGTACTAGCAAGGAGGGTGAATCATTCATCGTTGAATGGAATGAAAGTGAAGGAGC
TGTGAAGCGTACTTACCTCGGATTAGGGAAACGGTCTGTGGGGGTTGTTCAGTTCGATACCTTGAAGAATAAGTTTTTGG
TAGCTGGTGATGAGTTCCACGTCAAATTTTGGGACATGGATAGTGTTGAGCTCTTGACCACAACAACTGCAGACGGGGGA
TTGCCGTCTTCCCCTTGCTTAAGGATCAATAAAGAAGGAACTCTACTGGCTGTCTCAACTACTGAGAATGGAATCAAGAT
ACTAGCGAATGCTGAAGGTTCAAGGATTTTGCACTCCATGGCAAACCGTGGCGTTGAAAGCTCTAGAGCTCCTCCTGGAT
CTGTTTCAAAGGGTCCTATTGTTGGAACATTTGGGACTCCAAGTTCAAGCACTGGGATGAGTCTATCAATGGCTGAGAGA
AGTGGTCCAGGCGCTGCTGTTACTGCAATGAATGGCGATACTCGAAGTCTGTCAGATGTCAAACCACGAATCCCTGATGA
GGCAGAGAGATCAAAGGTTTGGAAGCTGGCAGAAATTAGTGAACGTTCGCAGCTTCGTACTCTGCGGCTACCTGACACTC
TGCTACCAGGAAGAATTGTCAAGTTAATATATACAAATTCTGGAGGTGCCATATTGGCATTAGCGGAAAACGCTCTACAC
AAGCTATGGAAATGGCAGAAGAGTGAGCGGAATCTTTCGGGAAAGGCAAACAGCAATGTCCCACCACAGCTTTGGCAGCC
ACCTAATGGAGTGCTAATGACAAATGACACACGTGAGGGAAACAAAGAAGACGTAGTTCCATGCTTTGCCCTCTCAAAGA
ATGATTCTTATGTCATGTCAGCCTCTGGAGGAAAAATTTCCTTGTTCAACATGATGACTTTTAAGACGATGACTACATTC
ATGGCGCCTCCTCCTGCAGCGACTTCCCTCGCCTTCCATCCTCAAGACAATAACATTATCGCTATTGGAATGGATGATTC
CTCTATTCAAATTTACAATGTTAGAGTGGATGAGGTTAAAAGTAAATTGAAAGGTCATCAGAAGAGAGTGACTGGTTTAG
CATTCTCAAACGTTCTGAATGTACTTGTTTCCTCTGGTGCTGATTCCCAGCTTTGTGTATGGAGCATGGATGGATGGGAA
AAGCAAGCTAGCAAACAGATACAAATTCCCAGCGGTCATTCGCCAAATCCGCTTGCTCATACACGCGTTCAGTTCCATCA
GGATCAGACACATGTTCTTGTTGTCCATGCCAGCCAGTTGGCGATATATGAGGCTCCTAAATTAGAGAACGTGAAGCAGT
GGATACCAACGGAGTCAAGTGGTTCAGTGACAGATGCTGTATACTCATGTGATAGCCAGTCTATCTACGCAGCCTTTGAT
GATGGAAGCGTGAGTATCTTGACGGCAACGACATTGCAACTGAAGTGCCGCATTGGTCCCAGTTCATATTTGCCTTCAAA
CCCGAGCTTGAGGTTATATCCAGCCACCATCGCAGCACATCCCTCTGAGCCAAACCAGTTTGCAGTTGGGCTTACTGATG
GTGGAGTTCATGTGATCGAACCACCAGGACCAGAAGGGAAGTGGGGAATGTCTCCACCTCCAGAAAACGGTGCAGGACCT
AGCGTCTCCTCAGCACCAGGTTCAGATCAGCAGCCGAGGTGA