Details for Chinese cabbage Locus Brara.A03098

Position : A01 ( 5`- 26180282 .. 26181916 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03098

Protein [Map View]
MQLFTSCCGKGFEGKKKVETEPARKIFSLKELHSATNSFNYDNKLGEGRFGSVYWGQLSDGSQVAVKRLKAWSNREEIDF
AVEVEILSRIRHKNLLSVRGYCDEGQERLLVYDYMPNLSLVSNLHGQQYSGECSLDSTARIKIAIRTAQALAYLHNHVVH
GDVRASNVLLDSEFEPRVMDFGYGKLMPDDDEATKARSSNGYLSPECVASGKETEAGDVYSFGILLLELVTGKRPIERLN
ATTKRGITEGVLPLVYERKFGEVMDQKLKEEKVEEKLKKLVLVGVMCVQTEAEKRPTMSQVVEMLMNESKEKISELEANP
LFKNPCREHQEVADEISEEQQ*

DNA
ATGCAACTTTTTACTAGCTGTTGCGGAAAAGGATTTGAAGGGAAAAAGAAAGTGGAGACAGAGCCAGCTCGGAAGATATT
CTCATTGAAGGAGCTTCACTCAGCCACAAACAGTTTCAACTACGACAACAAACTCGGTGAAGGTCGCTTCGGTAGTGTGT
ATTGGGGTCAGCTCTCTGATGGCTCACAAGTTGCAGTCAAGAGACTCAAGGCATGGAGCAACAGAGAAGAGATAGACTTC
GCTGTAGAAGTCGAGATTCTTTCCCGTATCCGTCACAAGAACTTGTTAAGCGTTCGTGGCTACTGTGATGAAGGACAAGA
ACGTCTTCTTGTATACGACTACATGCCGAACTTGAGCCTTGTCTCGAATCTTCATGGCCAGCAGTACTCAGGAGAGTGCT
CTCTAGATTCCACCGCTCGGATAAAGATTGCCATAAGAACTGCTCAGGCCCTAGCATACCTACACAATCATGTAGTCCAT
GGAGATGTCAGAGCTAGCAATGTGTTGCTAGACTCTGAGTTTGAGCCTCGGGTTATGGACTTTGGATATGGTAAACTGAT
GCCAGATGATGACGAAGCTACTAAAGCTAGAAGTAGTAATGGGTATCTCTCACCAGAATGTGTTGCGTCAGGGAAAGAAA
CAGAAGCAGGTGATGTGTACAGTTTTGGTATCTTATTGCTGGAGCTGGTTACTGGCAAGAGACCTATTGAGAGACTAAAC
GCAACTACAAAGCGTGGGATAACCGAGGGGGTGTTACCACTTGTTTACGAGAGAAAGTTTGGTGAAGTCATGGATCAGAA
GCTGAAAGAGGAGAAAGTGGAAGAGAAGCTGAAGAAGCTTGTCTTGGTGGGAGTCATGTGTGTTCAGACAGAGGCGGAGA
AGAGACCAACAATGTCTCAAGTGGTTGAGATGCTGATGAATGAATCAAAGGAGAAAATATCTGAGCTTGAAGCCAATCCT
CTCTTCAAGAATCCATGTAGAGAGCATCAGGAGGTTGCAGATGAGATCTCAGAAGAACAACAATAG