Details for Chinese cabbage Locus Brara.A03096

Position : A01 ( 5`- 26175696 .. 26179217 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03096

Protein [Map View]
MNHYADDLSLLDYNYNVSGPFGEPFSHRFLSPGPYFHGEDDDYRRSINHSLGGAYGGESNKDSRVSKQHRHDGKSPLPLG
MDWSAPPRQWEGRNTVWPHDPRTGWSYCVTVPSWVDLPRSTVSDPGVFYRVQVAIQSPEGITSTRLILRRFNDFLELYSS
IKKEFVKKRLPLPPPKKRLRMKNETLLEERRCALEDWMNRLLTDLDISRSALIATFLELEAAVRSYFNDEYQENEDSSVN
SQLRLPDTSSDAPGSSSVTMDHLSDSPDETSDTSTMKHDEASLKNIVSRNSTSEDNVTDWHELITESGLLDKSHFTDRAA
ETGTITGEASISRESNQDSMESHDDAHDGADTETGKDVAIVFQSEERSKLKRVVDTLEQRLETAKADTEDLISRLNQELA
VRQFLSTKVKDLEVELETTRESCKQGMEQTVLKEKERYTQIQWDMEELRKQCMEMESLLNFMKDEKAYTESTNESLVEEN
EMLLQQMDDLRDKFENLRKEHEELEVKSKAELKVLVKEVKTLRTTQSELRVELSRTMKEKLETERIVQREKDREETAKAA
NEKLMHECDVLQNRLRECDVKFHMEDESKLIMESSSPSEAMDLLATSDNRIGLLIAETQLLSEEHGGPDDVVRKMLTEVL
IDNARLRKQCNSVLRCSLSGHGVSVREARSEQEEEEEDQEGSVDLASTVLSKILEK*

DNA
ATGAATCACTACGCGGACGATCTCTCTCTTCTCGATTACAACTACAACGTCTCCGGTCCCTTCGGCGAGCCGTTCTCTCA
CCGTTTCCTCTCTCCTGGTCCTTACTTCCACGGCGAGGACGACGATTACCGCCGCAGTATCAACCATAGTCTCGGCGGAG
CTTACGGCGGAGAATCGAATAAAGATTCGAGGGTATCTAAACAACATCGCCATGACGGGAAGTCTCCGTTGCCTCTGGGG
ATGGATTGGAGTGCTCCTCCTCGTCAATGGGAAGGACGGAACACTGTTTGGCCACATGATCCTCGAACTGGTTGGAGTTA
CTGTGTCACTGTCCCCTCTTGGGTTGACCTTCCCAGATCAACTGTATCAGATCCTGGCGTGTTTTATAGAGTGCAAGTGG
CGATACAATCTCCCGAGGGAATCACCTCCACTAGGCTTATACTTCGAAGATTCAATGATTTCTTGGAGTTATATTCCTCA
ATTAAAAAGGAGTTTGTGAAGAAAAGGTTACCCCTGCCACCACCAAAGAAGAGACTGAGGATGAAAAACGAGACACTTTT
GGAAGAAAGGAGGTGCGCTCTGGAAGATTGGATGAATAGGCTTTTGACAGATCTCGATATCTCAAGAAGCGCTCTGATAG
CAACGTTCCTTGAGCTAGAAGCTGCTGTCAGGTCTTATTTCAATGATGAATATCAAGAAAATGAAGATAGCTCTGTTAAC
AGTCAGTTGCGTCTACCTGACACCAGTTCTGATGCTCCTGGTAGTTCATCAGTTACCATGGATCATCTCAGTGACTCTCC
TGATGAGACATCTGATACCTCAACAATGAAGCATGACGAAGCTAGTCTCAAAAACATTGTCTCAAGGAATTCAACTTCTG
AAGATAATGTGACTGACTGGCATGAACTAATCACAGAATCTGGACTTCTTGATAAGAGTCATTTTACTGATAGAGCTGCA
GAAACTGGAACCATAACCGGAGAGGCATCAATATCTAGGGAATCTAACCAAGACTCCATGGAGAGTCATGATGACGCTCA
TGATGGTGCTGATACTGAAACTGGGAAGGATGTGGCTATTGTATTTCAATCAGAGGAGAGAAGTAAGTTGAAGAGGGTTG
TTGATACGTTAGAGCAGAGGCTGGAAACAGCAAAAGCTGACACGGAAGATCTTATCTCACGGCTTAATCAGGAGTTAGCT
GTTCGACAATTTTTGTCAACAAAGGTAAAAGATTTAGAGGTTGAACTCGAAACAACTAGAGAGAGCTGCAAGCAAGGCAT
GGAGCAAACAGTTCTTAAGGAAAAGGAAAGATATACCCAAATCCAGTGGGATATGGAGGAGCTTCGCAAGCAGTGCATGG
AGATGGAATCATTGCTAAACTTTATGAAGGACGAGAAAGCATATACTGAGAGTACAAATGAGTCACTTGTTGAAGAAAAC
GAAATGTTGCTGCAGCAGATGGATGATCTAAGAGACAAGTTTGAGAATTTGCGTAAAGAGCATGAAGAGCTGGAGGTGAA
ATCGAAAGCAGAACTTAAGGTCCTTGTCAAAGAAGTCAAGACTCTCAGAACCACTCAATCAGAATTGAGAGTAGAGCTTA
GCCGCACGATGAAAGAAAAGCTGGAGACGGAGAGAATTGTTCAACGTGAGAAGGATAGAGAAGAGACTGCGAAAGCCGCA
AACGAGAAATTGATGCATGAGTGTGATGTTCTACAGAACCGTCTTCGAGAATGTGATGTCAAGTTCCACATGGAAGATGA
GAGTAAGTTAATAATGGAATCATCATCTCCATCCGAAGCGATGGATCTATTAGCAACATCTGATAACCGAATAGGTCTTC
TAATTGCTGAGACACAGCTTCTTTCAGAAGAACATGGAGGACCAGATGATGTAGTAAGAAAGATGCTAACAGAGGTGTTG
ATTGATAATGCGAGGTTAAGGAAACAGTGTAACTCTGTTCTTCGTTGCTCTTTGTCCGGACATGGAGTATCAGTCAGAGA
AGCTAGATCAGAACAAGAAGAAGAAGAAGAAGATCAAGAAGGGAGTGTTGATCTGGCAAGTACTGTTCTAAGCAAGATCC
TTGAGAAATGA