Details for Chinese cabbage Locus Brara.A03092

Position : A01 ( 5`- 26163018 .. 26163923 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03092

Protein [Map View]
AWRCINQDNNGVKGDDSIVIPKYDLNDIIKEESIKGSSSKTSSLITSLTEIVDNHKKRRWTTDVKIGKVSTTETSEKVTK
LKMTLKKYVGIKVRELVHRSDYEEILTMAARYEELTRAKVTYISRLATYGTVIREGFKASQRVKTVHQRVILHENVAIEK
QKRVDAEFELVKALAQKGDNLAVQIFAMKKAVLKLEAEKKQVEIQFQKSVENLSSVLEESSHAYEKHRVVVREWKEVQAS
AEYSLETIEKADVVWVQFLNTLT*

DNA
GCATGGCGCTGTATTAACCAAGACAATAATGGTGTTAAGGGAGACGATTCTATAGTTATACCAAAGTATGACTTAAATGA
CATCATCAAGGAAGAATCCATCAAGGGCTCCTCGTCAAAGACCTCTAGTCTCATAACATCGCTGACCGAGATTGTTGATA
ATCATAAGAAAAGACGATGGACGACAGATGTAAAAATAGGAAAGGTTTCTACTACAGAAACATCAGAGAAGGTAACGAAG
CTAAAAATGACCTTGAAAAAGTACGTTGGTATAAAGGTGCGTGAGCTCGTGCATCGTTCGGATTACGAGGAGATATTGAC
GATGGCTGCACGCTATGAGGAACTAACCCGTGCTAAGGTAACCTACATTTCGAGGCTGGCCACATACGGGACTGTGATAA
GAGAAGGATTCAAAGCCTCTCAGCGAGTGAAAACCGTGCACCAGCGTGTCATATTGCATGAAAACGTGGCCATAGAGAAG
CAGAAAAGGGTGGACGCTGAGTTCGAGTTAGTCAAGGCTTTGGCTCAGAAAGGAGACAACTTGGCCGTCCAAATATTCGC
AATGAAGAAGGCGGTGTTGAAGCTTGAGGCCGAGAAGAAACAAGTTGAGATTCAATTCCAGAAGAGTGTCGAGAATCTAT
CAAGCGTTCTAGAGGAATCGTCTCACGCATACGAGAAGCATCGTGTGGTTGTGCGCGAGTGGAAGGAGGTGCAAGCATCT
GCTGAATATTCGCTTGAGACCATCGAGAAGGCAGATGTCGTTTGGGTTCAGTTTCTCAACACTCTTACTTAG