Details for Chinese cabbage Locus Brara.A03088

Position : A01 ( 5`- 26111620 .. 26113260 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03088

Protein [Map View]
MQLHQEEWNIERKKAQEEQFSLINQLNSAKEVVTGLGQELSSDKKLSEELRAQIESLQSSLSKAGEDEKALETELRDKLD
LIEGLQDRINLLSLELKDKKEESQRVSTSLAEKEAEVEKLNSAYTQTSRDLADAIVEIKQVKEEVTRTQIELDSESFTIN
ELNTRISTLEGEEKSYTQKLDDVSKDYSALKLTSETQAAADAEDVNKSKDKFADLTKKYEDSKRMLDVELTNVHNVKDEL
EGTKRTNKVSVIRGEFDEAKERYEEKRAEERRNSEVLAKELAVEKDLLKKARDELEVEEAVKSLDEMNKNTSTLTKELEK
MNTHVSSLEDEKEVLQRTLEEANKASKKAKENMEGAYSFLMSLRKERGVIEKKVKKLEEDLGSAKGEILRMRSQPNSVKA
ENSTEDEEKSDDKVTAKKVVRRRKSSTSS*

DNA
ATGCAACTTCATCAGGAAGAGTGGAACATTGAACGGAAAAAAGCACAAGAGGAACAATTCTCATTGATCAACCAGTTGAA
TTCTGCAAAAGAAGTAGTGACAGGGCTAGGCCAGGAGCTAAGCAGCGATAAGAAATTATCTGAGGAGCTTAGAGCTCAAA
TAGAAAGTCTCCAAAGTAGTCTGTCAAAGGCTGGTGAAGACGAAAAGGCACTTGAAACAGAGCTCAGAGACAAGCTTGAT
TTGATTGAAGGGTTGCAAGATCGGATCAACTTGCTTAGTTTGGAACTGAAAGATAAAAAAGAGGAATCTCAACGCGTTAG
CACATCACTGGCTGAAAAAGAAGCAGAAGTGGAGAAACTCAACTCAGCTTACACTCAAACTAGCCGAGATCTTGCTGACG
CAATAGTAGAAATCAAGCAGGTTAAGGAAGAAGTTACAAGAACTCAGATTGAACTAGACTCAGAGAGTTTTACCATTAAT
GAGTTAAACACCAGAATAAGCACTTTAGAGGGTGAGGAAAAGAGTTACACCCAAAAGCTTGATGATGTATCAAAAGACTA
CAGTGCTTTGAAATTAACTTCTGAAACCCAAGCAGCTGCTGATGCGGAGGATGTTAATAAGAGTAAAGACAAATTCGCTG
ACCTAACTAAGAAGTACGAAGACTCGAAGAGGATGCTGGATGTAGAACTCACTAATGTGCATAACGTGAAAGATGAACTT
GAAGGAACGAAGAGAACAAACAAGGTTTCTGTGATTCGGGGAGAGTTTGATGAAGCTAAGGAAAGATATGAAGAGAAGCG
TGCTGAAGAAAGACGGAACAGTGAGGTTTTGGCTAAAGAACTTGCAGTGGAGAAAGATCTTTTAAAGAAAGCTAGAGACG
AGCTTGAGGTCGAAGAAGCAGTTAAGTCCTTAGATGAGATGAACAAAAACACATCGACATTGACAAAAGAGCTTGAGAAG
ATGAATACTCATGTTTCCAGTTTGGAGGACGAGAAAGAAGTGCTTCAAAGAACACTGGAAGAGGCAAATAAAGCATCAAA
AAAAGCCAAGGAAAACATGGAAGGCGCGTATAGCTTCTTGATGAGTCTGAGAAAAGAGAGGGGAGTGATAGAAAAGAAAG
TGAAGAAGCTGGAGGAGGACTTGGGATCTGCAAAGGGAGAGATACTGCGCATGAGGAGCCAACCGAATAGCGTAAAAGCT
GAGAATAGTACAGAAGATGAAGAAAAGAGTGATGATAAGGTTACTGCAAAGAAAGTTGTCAGGAGGAGAAAGAGCAGTAC
TAGTTCTTGA