Details for Chinese cabbage Locus Brara.A03081

Position : A01 ( 5`- 26086482 .. 26087161 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03081

Protein [Map View]
TKGTGSFGKRRNKSHTLCVRCGRRSFHIQKSRCSACAYPAARKRTYNWSVKAIRRKTTGTGRMRYLKNVPRRFKTCFREG
TEAKPRNKGAAAASSS*

DNA
ACAAAGGGAACAGGGAGTTTCGGTAAGAGGAGGAACAAGAGTCACACTCTGTGTGTAAGATGCGGTCGTCGTAGCTTTCA
CATCCAGAAGAGTCGCTGCTCCGCCTGCGCGTACCCTGCCGCTCGCAAGAGGACCTATAACTGGAGTGTGAAGGCGATCA
GGAGGAAGACAACAGGAACCGGTAGGATGAGATATCTCAAAAATGTCCCCCGCCGCTTCAAGACTTGTTTCAGAGAAGGT
ACTGAAGCCAAGCCAAGGAACAAGGGAGCAGCAGCAGCTTCATCATCCTAA