Details for Chinese cabbage Locus Brara.A03080

Position : A01 ( 5`- 26076343 .. 26079057 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03080

Protein [Map View]
MIRLRTYACLSFIATLSIIHHAFTTRGQFYPAAVYLSTSKISLMLLLNMCLVLMLALWHLVKLLFLGSLREAEVERLNEQ
AWRELMEILFAITIFRQDFSSGFLPLVVTLLLIKALHWLAQKRVEFIETTPNVSKLAHVRIVSFMAFLLVVDGLFMYSSV
RHLVRSRQASVSLFFSFEYMILATTTVAIFVKYVFFVTDMIMDGQWEKKPVYTFYLELIRDLLHLSMYICFFFVIFMNYG
VPLHLLRELYETFRNFQIRVSDYLRYRKITSNMNDRFPDATPEELTASDATCIICREEMTTAKKLICGHLFHVHCLRSWL
ERQQTCPTCRALVVPPENGTSTTAAGQRGLHQGSQQGTSSSGAQGSETRSSAGGSNDSLSRHHARLQAAASAAAMYGKSM
VYPSANTIAWSQPGTEKASTEAHHHPSSSSQLPGENSRAYANIPEAKLENMKNSLETQLEVLRNRLHFLEKRKVETTGEA
DNKGKTVVDASVDGAE*

DNA
ATGATCCGATTAAGAACCTACGCATGCCTCAGCTTCATCGCCACCCTCTCCATAATCCACCACGCCTTCACAACCCGGGG
CCAATTCTACCCCGCCGCCGTCTACCTCTCCACCTCCAAGATCAGCCTGATGCTCCTCCTCAACATGTGCCTCGTCCTCA
TGCTCGCCCTCTGGCACCTCGTCAAGCTCCTCTTCCTCGGCTCCCTCCGCGAAGCCGAGGTCGAGAGGCTGAACGAGCAG
GCCTGGAGAGAGCTCATGGAGATCCTCTTCGCCATCACGATCTTCCGTCAAGACTTCTCCAGCGGTTTCCTTCCCTTGGT
CGTTACGCTCTTGCTGATCAAGGCCTTGCATTGGCTCGCTCAGAAGAGAGTTGAGTTTATCGAGACGACTCCTAACGTCT
CTAAGCTCGCGCACGTTCGTATTGTTTCGTTTATGGCGTTTCTTCTTGTTGTGGATGGTTTGTTTATGTATAGCTCTGTG
AGGCATTTGGTTAGGTCGAGGCAGGCTTCGGTTTCTCTCTTCTTCTCTTTCGAGTATATGATTTTGGCGACGACGACTGT
GGCGATTTTTGTGAAGTATGTGTTCTTTGTTACTGATATGATTATGGATGGTCAGTGGGAGAAGAAGCCAGTTTATACTT
TCTATCTTGAGCTTATCCGTGACCTGCTTCATCTCTCTATGTACATTTGCTTCTTCTTTGTCATTTTCATGAACTATGGT
GTGCCTTTGCATTTGTTGAGGGAGCTCTATGAAACCTTCAGGAACTTCCAGATTCGTGTTTCTGATTACCTTCGTTATCG
TAAAATCACTTCCAATATGAACGACAGGTTCCCTGATGCCACTCCTGAAGAACTTACTGCAAGTGATGCCACATGTATTA
TATGCCGTGAAGAAATGACAACTGCGAAGAAGCTGATATGCGGGCATCTTTTTCATGTGCATTGTCTTCGATCCTGGTTG
GAACGACAGCAGACATGTCCTACTTGCAGGGCACTCGTTGTACCTCCTGAGAATGGCACATCTACTACAGCTGCAGGCCA
ACGAGGATTACACCAAGGTTCTCAACAAGGTACTTCAAGCTCAGGTGCCCAGGGATCTGAAACACGTTCTTCTGCTGGTG
GTTCCAATGATAGCTTGAGCAGGCACCACGCCAGGCTTCAAGCAGCTGCTTCTGCAGCCGCCATGTACGGGAAGTCAATG
GTTTATCCATCTGCAAACACAATAGCGTGGTCTCAGCCGGGTACAGAGAAAGCTTCAACAGAAGCACATCATCATCCTTC
ATCATCATCTCAGCTTCCTGGTGAAAACTCTCGTGCCTATGCAAATATCCCAGAGGCTAAGCTGGAAAATATGAAGAACT
CTTTAGAGACCCAGCTCGAGGTTTTGCGAAACAGACTTCATTTTCTGGAGAAGAGGAAAGTGGAAACCACAGGGGAAGCA
GATAACAAAGGAAAGACGGTTGTTGATGCTTCTGTAGATGGAGCAGAGTGA