Details for Chinese cabbage Locus Brara.A03077

Position : A01 ( 5`- 26065707 .. 26067001 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03077

Protein [Map View]
MASLATVAAVKPSAAVNGLGGSSLAGAKLSFKPSSLSIKPKSVRSGAVVAKYGDKSVYFDLEDLGNTTGQWDLYGSDAPS
PYNPLQSKFFETFAAPFTKRGLLLKFLILGGGSLLTYVSASSTGDVLPIKRGPQEKPKLGPR

DNA
ATGGCGTCTCTTGCAACCGTCGCCGCCGTGAAACCATCTGCCGCCGTCAACGGCCTCGGCGGCAGCTCACTCGCCGGGGC
CAAGCTCTCCTTCAAACCTTCCAGCCTAAGCATCAAACCCAAATCCGTCAGGTCTGGTGCCGTGGTGGCCAAGTATGGAG
ACAAAAGTGTCTACTTTGACTTAGAAGATTTGGGAAACACAACTGGTCAATGGGATCTATACGGATCTGATGCTCCTTCT
CCTTACAACCCTCTTCAGAGCAAGTTTTTTGAGACATTCGCTGCACCATTCACAAAGAGAGGATTGCTCCTCAAGTTCTT
GATTCTTGGAGGAGGATCTTTGCTTACTTATGTCAGCGCTTCATCCACCGGCGATGTTCTTCCCATCAAGAGAGGTCCTC
AGGAGAAGCCTAAGCTCGGTCCTCGC