Details for Chinese cabbage Locus Brara.A03076

Position : A01 ( 5`- 26061201 .. 26062744 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03076

Protein [Map View]
MGRWAIAVHGGAGIDPNLPVERQEQAKQLLTRCLNLGIAALRSNVSAIDVVELVVRELETDPLFNSGRGSALTENGTVEM
EASIMDGTKRRCGAVSGITTVKNPISLARLVMDKSPHSYLAFSGAEEFARKQGVETVDNEYFVTEDNVGMLKLAKEANSI
LFDYRVPLIGCAGAAVNDSPLQMNGLPISIYAPETVGCVVVDREGRCAAGTSTGGLMNKMMGRIGDSPLIGAGTYASELC
GVSCTGEGEAIIRSTLARDVSAVMEYKGVGLQEAVDYVIKHRLDEGFAGLIAVSNKGEVVCGFNSNGMFRGCATEDGFME
VAMWE*

DNA
ATGGGCAGATGGGCAATCGCAGTACACGGTGGCGCCGGAATCGACCCTAACCTTCCCGTCGAAAGACAAGAACAGGCCAA
ACAGCTTTTGACTCGCTGTCTCAACCTAGGCATAGCAGCTTTACGCTCCAATGTCTCCGCCATTGACGTCGTTGAGCTCG
TCGTGAGAGAATTGGAGACAGATCCTCTGTTTAACTCAGGTCGTGGATCTGCTTTGACGGAGAATGGAACGGTTGAGATG
GAAGCGAGCATTATGGACGGTACGAAGAGACGATGCGGCGCCGTTTCGGGGATCACCACCGTGAAGAACCCGATATCTCT
CGCTCGTCTCGTCATGGACAAATCTCCCCACTCTTACCTCGCTTTCTCCGGCGCGGAGGAGTTCGCCCGCAAACAGGGAG
TTGAAACTGTGGACAACGAGTACTTCGTCACGGAAGACAACGTGGGGATGCTCAAGCTGGCCAAAGAAGCCAACTCCATC
TTGTTTGATTACCGGGTCCCACTGATAGGATGCGCCGGCGCCGCCGTAAACGACAGTCCACTCCAGATGAACGGACTTCC
GATCAGCATTTACGCGCCGGAGACAGTAGGATGCGTGGTGGTGGACAGAGAAGGAAGGTGCGCCGCCGGGACATCAACGG
GAGGTCTGATGAACAAGATGATGGGAAGGATAGGAGACTCGCCGCTGATAGGAGCAGGGACGTATGCGTCTGAGCTTTGT
GGAGTGTCGTGCACCGGAGAAGGGGAAGCCATCATAAGGTCGACGCTGGCGCGTGACGTGTCGGCTGTTATGGAGTACAA
AGGAGTTGGGCTACAAGAAGCGGTTGATTACGTCATCAAGCATCGGCTCGACGAAGGGTTCGCTGGACTCATTGCCGTGT
CGAATAAAGGAGAGGTGGTTTGTGGGTTTAACTCTAATGGGATGTTCAGAGGATGTGCAACTGAGGATGGGTTCATGGAA
GTTGCTATGTGGGAGTGA