Details for Chinese cabbage Locus Brara.A03075

Position : A01 ( 5`- 26059498 .. 26061184 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03075

Protein [Map View]
MTSRGEREGNNNTDHQDGVTGRKQKRCRCRQSKCLKLYCDCFASGVLCNDCDCADCHNNTDNSYLREAAVLNLLDRNPNA
FNGKPPSFLINKQAAADTKLGLLSRGCKCKRTKCLKKYCECFQANALCSDNCKCINCENQWNSCPAPLSSMPDNYVLDSL
ESPMYSSTKLPYKKKRSRLGCTTPKLVPDLGDLRSLLLAASESATANAGLQDKNRIRIKPDDKELWNESESGIVEEEDIQ
SCGRLIQLIDAQYNDEVDPQTKTSFPERDAYMEQERAVLETFRDCLHKYMKKIGFMK

DNA
ATGACCTCTCGCGGAGAGAGGGAAGGTAACAACAACACAGATCATCAGGATGGCGTTACAGGGAGGAAGCAGAAACGATG
TCGCTGCAGGCAGTCTAAATGCTTGAAACTGTACTGTGACTGCTTTGCGTCAGGAGTGTTATGTAACGACTGTGATTGTG
CTGATTGTCACAACAACACTGACAACTCTTACCTCAGAGAAGCAGCTGTTTTGAATTTACTAGATCGTAATCCAAATGCA
TTCAACGGAAAGCCTCCCAGCTTCCTAATTAACAAGCAGGCTGCAGCTGATACTAAACTCGGACTGCTTTCGAGAGGATG
CAAATGCAAAAGAACCAAGTGCCTGAAGAAGTACTGCGAATGCTTTCAAGCTAATGCTCTGTGCTCTGACAACTGTAAAT
GCATCAACTGCGAGAATCAGTGGAATTCGTGTCCAGCTCCTTTAAGTTCGATGCCTGACAATTACGTTCTTGATTCTCTC
GAGTCCCCTATGTACAGCTCTACTAAACTCCCTTACAAAAAGAAAAGGTCACGGCTAGGATGTACCACTCCCAAACTCGT
TCCAGACTTGGGGGATCTAAGATCGCTTCTCTTAGCAGCATCTGAATCTGCTACAGCCAATGCAGGTTTACAAGACAAGA
ACAGGATACGCATAAAGCCTGATGATAAGGAGCTATGGAATGAGTCTGAGAGCGGTATTGTGGAAGAAGAAGACATACAA
TCCTGTGGAAGATTGATCCAACTGATTGATGCTCAATACAATGACGAGGTGGATCCCCAAACCAAGACAAGTTTCCCTGA
AAGAGATGCATACATGGAGCAGGAAAGAGCAGTGCTTGAAACTTTCAGAGACTGCCTCCACAAGTACATGAAAAAGATTG
GGTTCATGAAA