Details for Chinese cabbage Locus Brara.A03074

Position : A01 ( 5`- 26050319 .. 26054370 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03074

Protein [Map View]
MTATLKRFNYLSFINSPLLHNSNRHRLPRFFQPPNHLFSSQCGSLMEVFKAAFSEGSNASDRIAIKADGKSYSYGQLTSS
AFTISKLFHKEDTKNGGESRRCDGFGSLQGARVGIVAKPSAEFVARVLGTWFSGGVAVPLALSYPEAELLYDISVLLSTE
DHSETMKTIAAKSDARFHLIPPVVNSTSETITHNQFQDDSFEGEDKLLDDPALIVYTSGTTGKPKGVVHTHKSINSQVIM
LTEAWEYTSADHFLHCLPLHHVHGLFNALFAPLYARSSVEFLPKFSVSGIWRRWRESYPLNDEKTNDAITVFTGVPTMYS
RLIQGYEAMDQETRESSAFAAQKLRLMMSGSSALPRPVMHQWESITGHRLLERYGMTEFVMAISNPLRGARKAGTVGKPL
PGVEAKIEQDENDTDGVGEICIKSPSLFKEYWNLPQVTKESFTEDGYFKTGDAGRVDEDGHYVILGRTSADIMKVGGYKL
SALEIESTLLEHPTVAECCVLGLPDKDYGEAVTAIIVAETGAKRKREEESKPVMTLEELCGWAKDKLAPYKLPTRLLIWE
SLPRNAMGKVNKKELKKSLDHQE*

DNA
ATGACAGCAACATTAAAGCGTTTCAACTACTTGTCTTTCATTAACTCTCCTCTGCTCCACAACTCCAATCGTCATCGTCT
TCCTCGATTCTTCCAGCCACCTAACCATCTCTTCTCTTCACAGTGTGGTTCACTCATGGAAGTGTTTAAAGCAGCTTTTT
CAGAAGGTTCTAATGCCTCTGATAGGATAGCTATTAAGGCCGATGGAAAGAGTTACTCTTATGGCCAGCTTACATCCTCT
GCCTTTACCATCTCTAAGTTGTTCCACAAGGAAGATACTAAAAATGGAGGTGAAAGTAGGAGGTGTGATGGGTTTGGTAG
TCTACAAGGAGCTAGAGTTGGAATTGTGGCGAAACCATCAGCTGAGTTTGTTGCACGAGTACTTGGGACTTGGTTTAGTG
GTGGCGTGGCAGTTCCACTTGCACTCAGCTATCCAGAGGCTGAACTCTTATATGATATATCTGTGTTATTGAGCACGGAG
GACCACAGTGAAACTATGAAAACTATAGCAGCAAAGAGTGACGCTAGATTTCATCTGATTCCCCCTGTTGTTAACTCAAC
TTCGGAAACTATTACTCACAATCAGTTTCAAGATGACAGCTTTGAAGGAGAAGATAAACTTCTAGATGATCCAGCATTGA
TCGTGTACACTAGTGGTACAACTGGTAAACCAAAAGGAGTTGTCCATACCCACAAAAGCATCAACTCCCAGGTTATAATG
CTAACTGAAGCTTGGGAGTACACATCTGCTGATCACTTTCTCCACTGCCTCCCACTACATCATGTTCATGGTCTTTTCAA
TGCTTTGTTTGCCCCTCTTTACGCCCGGTCTTCGGTTGAGTTTTTGCCCAAGTTTAGTGTTAGTGGAATCTGGCGCAGAT
GGCGTGAATCATATCCGTTGAATGATGAGAAAACCAACGACGCCATAACTGTATTCACTGGAGTTCCAACCATGTATAGT
CGGTTGATACAAGGTTATGAAGCAATGGATCAAGAAACGAGAGAGTCTAGCGCTTTTGCTGCGCAGAAGCTTCGCCTAAT
GATGTCTGGCTCCTCTGCTCTTCCTAGGCCGGTCATGCATCAGTGGGAAAGTATCACCGGTCATCGTCTTTTGGAACGAT
ATGGCATGACTGAGTTTGTAATGGCAATATCAAACCCCTTACGTGGTGCACGGAAGGCAGGTACCGTCGGTAAACCACTT
CCCGGTGTTGAGGCTAAGATTGAACAAGATGAAAACGATACGGATGGAGTGGGTGAGATCTGTATAAAGAGCCCATCTTT
GTTCAAGGAGTACTGGAATCTTCCACAAGTTACTAAAGAATCATTCACGGAAGATGGATACTTCAAGACCGGGGATGCTG
GTCGAGTTGATGAGGATGGACATTACGTGATTCTCGGACGTACTAGCGCTGATATTATGAAGGTTGGAGGTTACAAGTTG
TCTGCTTTAGAAATCGAATCAACCCTACTCGAGCACCCAACGGTTGCAGAGTGTTGCGTGTTGGGGTTGCCAGACAAAGA
CTATGGGGAAGCGGTTACAGCGATAATTGTAGCAGAGACTGGAGCAAAGAGGAAAAGAGAAGAAGAGTCAAAACCTGTGA
TGACCTTAGAAGAACTCTGCGGTTGGGCTAAAGACAAACTTGCTCCTTACAAGCTACCAACCCGTTTGCTGATATGGGAG
AGCTTGCCTCGCAACGCCATGGGAAAGGTGAACAAAAAAGAGCTAAAGAAATCTCTGGATCATCAGGAGTAG