Details for Chinese cabbage Locus Brara.A03069

Position : A01 ( 5`- 26022632 .. 26024854 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03069

Protein [Map View]
MDLFKDSSKQNLSLGNHGGSSTDHPSPHVSKGKQIVQVYRELYTHFISFPLAIHPELKEKVETFRNSILGDNKDKKPLKF
QSTLDEMGIENRMFISPNSLHLTVVMLRLVNKEAVDAAQDILKSISARVMYALDNRPVFIRLKGLSSMNGSLEKTRVLYA
PVEEVGDEGRLLRACHTIIDAFANAGFAGRDAKLHLKLHVTLMNTTYRRDERKSNTFDAREIHKEFGEKDWGEYLIREAQ
ISKRFWYDADGYFHCCGSLPFPH*

DNA
ATGGATTTGTTCAAGGACTCGTCAAAGCAGAATTTATCATTAGGGAATCACGGGGGATCTTCCACTGATCATCCCAGTCC
ACATGTCTCCAAAGGCAAACAGATTGTACAAGTTTATAGAGAACTGTACACACACTTTATCTCATTTCCATTAGCCATAC
ACCCTGAGCTTAAAGAAAAGGTTGAGACTTTTCGGAATTCTATATTGGGTGACAATAAGGATAAGAAACCTTTGAAGTTT
CAGAGCACTTTGGATGAAATGGGAATCGAAAACAGGATGTTTATTTCGCCAAATAGTTTACACTTGACTGTGGTTATGTT
AAGGCTAGTAAACAAGGAAGCTGTGGATGCAGCTCAGGATATCCTTAAGAGTATCTCTGCGCGTGTGATGTATGCTTTGG
ATAACCGTCCTGTCTTCATACGACTTAAAGGATTGAGTTCTATGAATGGATCTTTAGAGAAAACCCGCGTGCTTTATGCA
CCTGTTGAAGAAGTTGGGGATGAAGGCCGGCTGCTAAGGGCTTGTCATACTATCATTGATGCATTTGCGAATGCTGGATT
TGCTGGGAGAGATGCAAAGCTACACTTGAAGCTACATGTCACGCTGATGAATACCACCTACAGAAGGGATGAAAGGAAAT
CAAATACATTTGATGCACGAGAGATACACAAAGAGTTTGGGGAAAAAGATTGGGGTGAATATCTAATCAGAGAAGCTCAG
ATCTCAAAGCGGTTTTGGTATGACGCGGACGGCTACTTCCATTGCTGTGGTTCACTACCTTTTCCACATTAA