Details for Chinese cabbage Locus Brara.A03060

Position : A01 ( 5`- 25960667 .. 25963106 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03060

Protein [Map View]
MAQKVEAQGGNGGNQWDDGSEHDAVTKIQTAAGGSGNQYVQFDYVKNGQTETAPLRGIKGRAIAADPFVINHPEEHLVSV
EGWYDSSGIIQGLKFNSNKKSSDVIGYNDGTPFTLQVQDKKIIGFHGFAGDNLNSLGAYFAPLIAAPPSVPPKKLEAKGG
MSGAEWDDGAHDNVKKVSIGQGEDGVAAVKFEYTNGSQVVIGAERGIPTLLGYEEFELESDEYITIVEGTYDKILGSDGL
TMLTFKTNKNRTYGPYGLEGSTHFDLKEEGYKITGFHGRAGATISAIGVYLAPVGTIPLTPAQPTKKLEAKGGEGGTSWD
DGAFDGVRKVSVGQAQDGISAVKFVYNKGSSEIIGDEHGKSTLLGFEEFELDYPNEYITEVNGTFDRIFGSDSAVLTMLT
FKTNKPATYGPFGLTAGEAFDLKEEGHKIVGFHGSTGDLLHKFGVHVLPITN*

DNA
ATGGCCCAAAAGGTGGAAGCACAAGGAGGCAATGGAGGCAACCAATGGGATGATGGATCAGAACACGATGCTGTAACCAA
GATTCAGACAGCTGCAGGTGGGAGCGGTAACCAATATGTTCAGTTCGACTATGTCAAGAACGGACAAACCGAAACAGCCC
CTCTTCGCGGTATCAAGGGCCGTGCCATCGCAGCTGATCCGTTTGTGATTAACCATCCAGAGGAGCATCTAGTTTCAGTA
GAAGGTTGGTATGACTCTTCTGGTATCATTCAAGGGCTTAAGTTCAACTCCAACAAGAAGTCTTCTGATGTTATTGGATA
CAATGATGGTACTCCATTTACCCTCCAAGTTCAAGACAAGAAGATTATTGGCTTTCATGGATTCGCTGGAGACAATCTTA
ATTCTCTTGGAGCTTACTTTGCTCCATTAATAGCCGCCCCTCCTTCAGTTCCCCCGAAGAAGCTTGAAGCTAAGGGTGGT
ATGTCTGGAGCTGAGTGGGACGATGGTGCTCACGACAATGTTAAAAAGGTATCTATAGGACAGGGCGAAGATGGTGTAGC
AGCTGTCAAGTTTGAATACACAAATGGTTCTCAAGTGGTTATTGGAGCTGAACGTGGGATACCAACATTGCTTGGATACG
AAGAGTTTGAGCTTGAATCAGATGAATACATAACCATCGTGGAAGGCACCTACGACAAAATCTTAGGGAGTGATGGCCTG
ACGATGCTTACTTTCAAGACTAACAAGAACAGAACATATGGGCCGTATGGCCTCGAAGGTAGCACACACTTTGACCTCAA
GGAGGAAGGTTACAAGATTACAGGGTTCCATGGACGAGCTGGCGCGACTATTAGTGCTATTGGAGTTTACTTAGCTCCAG
TAGGCACCATCCCCTTGACTCCTGCACAACCAACCAAGAAGCTAGAAGCTAAGGGTGGTGAGGGAGGAACATCATGGGAT
GATGGTGCTTTCGACGGTGTACGAAAAGTGTCTGTAGGACAAGCCCAAGATGGTATATCAGCGGTTAAGTTTGTGTACAA
CAAAGGTTCTTCTGAAATCATAGGAGATGAACATGGAAAGAGTACTCTACTTGGATTCGAAGAGTTTGAGCTTGACTATC
CAAATGAATACATCACGGAAGTAAATGGCACATTCGATAGAATCTTTGGGAGTGACTCCGCGGTACTTACCATGCTTACG
TTCAAGACTAATAAGCCAGCAACATATGGTCCCTTTGGGCTTACCGCTGGCGAGGCCTTCGATCTCAAGGAGGAAGGCCA
CAAGATCGTTGGGTTTCATGGAAGTACTGGTGATCTGCTTCATAAATTTGGAGTCCACGTCCTTCCCATCACCAACTGA