Details for Chinese cabbage Locus Brara.A03056

Position : A01 ( 5`- 25928478 .. 25930579 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03056

Protein [Map View]
MEGCPRNRELCPKLLDLIPQARQWYHEENNNTDQEKKLELRLGPPGGYDEDRPATKKNTETRNNNIKKEAEDKSIFSPSK
NHFSPSNRTNLPHISHKRTAPGPVVGWPPVRSFRKNLATTSSSKLVNESSHIGQINKNGDGVKQVEPKREGMFVKINMDS
VPIGRKIDLNAYNSYEQLSFGVDKLFRGLLAAQRDTSGGEGEEKPIIGLLDGKGEFTLTYEDNEGDKMLVGDVPWQMFVS
SVKRLRVIKSSEISSALRFGCSKHEKMRN*

DNA
ATGGAAGGTTGTCCAAGAAACAGAGAACTCTGTCCTAAACTCCTTGATTTGATTCCTCAAGCAAGACAATGGTACCATGA
AGAAAACAACAACACAGATCAAGAAAAGAAACTTGAGCTAAGGCTTGGACCACCCGGTGGTTATGACGAAGATCGTCCAG
CAACGAAGAAGAACACAGAGACAAGAAACAACAACATCAAGAAAGAAGCAGAAGACAAATCTATCTTCAGTCCCAGCAAA
AACCATTTCTCTCCATCCAACAGAACTAATCTTCCTCACATCTCTCATAAAAGAACCGCCCCTGGTCCAGTGGTGGGTTG
GCCTCCGGTTCGTTCATTCAGAAAAAATCTAGCGACTACAAGCTCTTCAAAGCTGGTAAACGAATCCTCCCACATAGGTC
AAATCAATAAGAATGGTGATGGTGTGAAGCAAGTCGAACCTAAGAGGGAAGGCATGTTTGTAAAGATCAACATGGACAGT
GTTCCAATTGGTAGAAAAATAGATCTCAATGCTTACAATAGCTACGAACAGCTCTCTTTTGGTGTAGACAAACTCTTCAG
AGGTCTACTCGCAGCTCAAAGAGATACCTCTGGTGGTGAAGGAGAAGAGAAACCCATCATTGGTTTACTGGATGGTAAAG
GAGAATTTACTTTAACTTATGAAGACAATGAAGGGGACAAGATGCTTGTTGGGGATGTTCCTTGGCAAATGTTCGTTTCA
TCTGTCAAGAGGCTGCGTGTGATTAAAAGCTCTGAGATTTCATCTGCTTTGAGATTTGGATGCAGTAAGCACGAGAAGAT
GAGGAACTAA