Details for Chinese cabbage Locus Brara.A03053

Position : A01 ( 5`- 25909101 .. 25911071 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03053

Protein [Map View]
MFLSLLDSCIRSQNLILGQIIHQHLLKRSLLTLTYPTVLVKLTRLYASCNELKLARHAFDEIPHPRTNPIPWDVMIRAYA
SKDHPEKALDLYYNMLSSGVRPTKYTYPFALKACAGLRAIEDGKLIHTHAKGSGFSDDLYVCTALVDFYAKCGEIDMAIQ
VFDEMHERDVVPWNAVISGVSLYFGLADVIALFKDMRRRDGLSPNLSTIVGMFPALGRSGGALREGKSVHGYCIRMGFSD
DVVFKTGILDVYSKSKCIVYARRVFDSGFLKNEVTWSAMIGGYIESEMMMEAGGLFLQMLDHGDVAVVTPVAVGLILMGC
ARFGDVNGGRCVHCYAVKAGFISDLTVGNTVISFYAKYGSLCDAFRQFSEIGVKDIVSYNSLISGCVENCRTEESLRLFH
EMKCSGVRPDITTLLGVLTACSHLAALRHGFSCHGYCVVYGYAVNTTVCNALIDMYTKCGKLDVAKRVFDTMHKRDTVSW
NTMMFGFGNHGLGNEALSLFDSMRDTGVNPDDVTFLALLSACSHSGLVDEGRQVFNSLTRGDFSFTPRIDHYNCMADLLA
RAGYLDEAYDLVNKMPFEPDVNVLGTLLSACMTYKSVELGDKVSKKMHSLGGTTGSFVLLSNTYSAVERWEEAEIIRTTQ
KKTGLHKTPGYSWVDV*

DNA
ATGTTTCTAAGCCTTCTCGACTCATGTATCCGATCACAGAACCTAATCCTAGGCCAAATCATTCACCAGCATCTTCTCAA
ACGCTCCCTCCTCACGCTCACTTACCCTACCGTGCTCGTCAAGCTAACGCGCCTCTACGCCTCATGCAACGAATTGAAAC
TTGCACGCCACGCGTTCGACGAAATTCCTCACCCAAGAACCAATCCCATCCCCTGGGACGTGATGATCAGAGCCTACGCA
TCGAAAGATCACCCGGAAAAAGCTTTGGATTTGTATTACAATATGCTGAGTTCTGGCGTTAGACCCACGAAGTACACGTA
CCCTTTTGCCCTGAAGGCGTGTGCTGGCCTGCGAGCGATCGAAGATGGTAAGCTGATACATACCCATGCGAAAGGTAGCG
GCTTTAGTGATGATTTGTATGTGTGTACTGCCCTGGTCGATTTCTATGCTAAATGTGGGGAAATCGATATGGCAATCCAG
GTGTTCGACGAAATGCATGAGAGAGATGTTGTTCCTTGGAACGCTGTGATTTCTGGGGTTTCTTTGTATTTCGGTTTAGC
TGATGTTATTGCGTTGTTTAAGGATATGCGTAGAAGAGATGGGCTGAGCCCTAATTTATCCACCATCGTTGGGATGTTTC
CTGCGTTAGGAAGGTCTGGTGGTGCTTTGAGGGAAGGGAAGTCAGTTCATGGGTACTGCATAAGAATGGGGTTTAGTGAT
GATGTTGTTTTCAAGACGGGAATCTTGGATGTTTATTCGAAAAGCAAGTGCATTGTCTACGCGAGGAGAGTTTTTGATTC
GGGCTTTTTAAAGAATGAGGTGACGTGGAGTGCTATGATTGGAGGCTACATAGAAAGTGAGATGATGATGGAAGCTGGGG
GATTGTTCTTGCAGATGTTGGATCATGGAGATGTGGCAGTTGTGACGCCGGTGGCCGTTGGGCTTATTCTGATGGGTTGT
GCGAGGTTTGGAGATGTGAATGGAGGGAGATGTGTGCATTGTTACGCGGTTAAAGCTGGCTTTATCTCAGACCTAACCGT
TGGAAACACCGTAATTTCGTTTTACGCCAAGTATGGAAGCTTATGTGATGCTTTTAGGCAGTTTAGTGAGATTGGCGTGA
AAGATATTGTTTCATATAACTCTCTCATCTCTGGCTGTGTGGAGAACTGTCGCACCGAAGAGAGTTTGCGTCTGTTTCAT
GAAATGAAATGTTCTGGAGTTCGTCCAGATATAACAACGTTGCTTGGTGTCTTGACCGCTTGCTCTCACTTGGCTGCTTT
GAGACACGGTTTCAGCTGCCACGGGTATTGCGTTGTTTACGGCTATGCAGTTAATACAACCGTTTGTAACGCATTGATTG
ATATGTACACAAAGTGCGGTAAACTCGATGTCGCCAAGAGAGTTTTCGACACGATGCATAAGCGGGATACTGTTTCGTGG
AACACAATGATGTTTGGCTTTGGAAACCATGGCCTTGGCAACGAAGCTCTTTCTCTGTTCGATAGTATGCGGGACACAGG
TGTGAACCCAGACGATGTGACTTTTCTTGCTCTTCTCTCTGCTTGTAGCCATTCAGGACTTGTGGATGAAGGGAGACAAG
TGTTCAACTCTCTGACTCGCGGAGATTTTAGCTTCACCCCAAGGATAGACCATTATAATTGCATGGCTGATCTCCTAGCT
CGTGCCGGATACTTGGATGAAGCGTATGATCTTGTCAACAAGATGCCGTTTGAGCCAGACGTTAATGTGTTGGGTACACT
TCTCTCTGCTTGTATGACGTACAAGAGTGTGGAGCTTGGGGATAAAGTGTCGAAAAAGATGCACAGTCTTGGAGGAACAA
CAGGAAGCTTTGTTCTTTTATCCAACACCTATTCAGCTGTTGAAAGATGGGAAGAGGCAGAGATTATTAGAACGACTCAG
AAGAAAACAGGGCTGCACAAGACCCCGGGTTATAGCTGGGTTGATGTTTAA