Details for Chinese cabbage Locus Brara.A03051

Position : A01 ( 5`- 25900583 .. 25901968 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03051

Protein [Map View]
MLVYTDLLTGDELLSDSFPYKEIENGILWEVEGKWTTKGCVEVNIGANPSAEEGGEDEGVDDSVEKVVDIVDTFRLQEQP
TYDKKGFIAYIKKYIKLLTPKLTPEQQDEFKKGIEGATKYLLPKLKDFQFFVGEGMHDDSTIVFAYYKEGATNPTFLYFG
HGLKEVKC*

DNA
ATGTTGGTGTACACTGATCTTCTCACCGGTGATGAGCTTCTCTCTGACTCTTTCCCGTACAAGGAGATTGAGAATGGTAT
TCTTTGGGAAGTTGAAGGAAAGTGGACTACTAAGGGATGTGTAGAGGTTAACATTGGTGCCAACCCATCTGCTGAGGAAG
GTGGTGAGGACGAGGGTGTTGACGACTCTGTTGAAAAGGTTGTTGACATTGTCGACACCTTCAGGCTTCAGGAGCAGCCC
ACTTACGACAAGAAGGGGTTCATCGCCTATATCAAGAAGTACATCAAGCTTTTGACACCCAAGCTCACCCCGGAACAGCA
AGATGAGTTCAAGAAGGGTATTGAGGGTGCTACCAAGTACTTGCTCCCCAAGCTCAAGGACTTCCAATTCTTTGTTGGGG
AGGGGATGCACGATGACAGCACTATCGTCTTTGCTTACTACAAGGAAGGTGCTACGAACCCAACATTTTTGTACTTCGGA
CATGGTTTGAAGGAGGTCAAGTGCTGA