Details for Chinese cabbage Locus Brara.A03043

Position : A01 ( 5`- 25856821 .. 25857576 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03043

Protein [Map View]
MYSNENDQLVTVFLTFIFLFFMCFNIYYLYVHWCLHRPTMLFFAPTNPSHTGLDPAIVKSLPVFTFSDVSHKDPIDCPVC
LSEFEDGESGRVLPGCKHAFHVECIDMWFHSHSTCPLCRSLVHAVEEQVTVIAISPEHVSATEPVSSSGSGSSAMPLDDL
RREPAEIETPRRIFSEFEDGLTRNSPVNHSPMSRMLSFTRMVSRNRRSAPSSFAGAPSQSPSSSCQVVMNESDIERGGEE
IKIDFRHVGVP*

DNA
ATGTACAGCAACGAGAATGACCAGTTGGTGACAGTCTTCCTTACATTCATCTTCTTGTTCTTCATGTGTTTCAACATCTA
CTATCTCTACGTTCACTGGTGTCTCCACCGCCCTACAATGCTTTTCTTCGCCCCCACCAATCCTTCTCATACCGGTCTAG
ATCCCGCCATCGTGAAATCTCTCCCTGTTTTCACTTTCTCAGACGTGTCTCACAAGGATCCGATTGATTGCCCCGTTTGT
CTTTCAGAGTTCGAAGACGGCGAGTCGGGTCGGGTTTTGCCCGGTTGTAAACACGCATTTCATGTTGAATGTATTGATAT
GTGGTTTCATTCTCACTCAACTTGTCCTCTCTGCCGTTCTCTCGTTCACGCAGTGGAGGAGCAAGTCACGGTCATCGCGA
TTTCTCCTGAACATGTTTCTGCTACTGAACCGGTATCGAGCTCGGGATCTGGTTCTTCTGCGATGCCGTTGGATGATTTA
AGGAGAGAACCAGCGGAGATTGAGACCCCTAGGAGGATTTTCAGCGAGTTCGAAGACGGTTTGACACGGAATTCGCCGGT
GAATCACTCGCCGATGAGTCGGATGTTATCTTTTACTCGGATGGTGAGTAGAAATCGAAGAAGTGCACCGTCTTCTTTTG
CCGGAGCTCCGTCTCAATCGCCGTCGTCAAGCTGCCAGGTAGTGATGAACGAGTCGGATATTGAGCGGGGAGGAGAAGAG
ATTAAAATTGATTTCCGCCACGTGGGTGTTCCTTAG