Details for Chinese cabbage Locus Brara.A03042

Position : A01 ( 5`- 25851661 .. 25855084 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03042

Protein [Map View]
MTSHGVERIHRVQPERDLVANWEVDLSEKLEEYLLKICSGEITGTEEDSPVNFAEAALLLQGSVQVYSKKVEYLYNLVLR
TLEFLSNQREQEESKGTSNEAEASSSRQVDEEENDLFWNVDDIPVDAKNSLDNSVGGDSCPSQFVKPPANLVVLEGDCLD
TSGDGGELESYLLATTHLYRDFILLDPCDAVAVNEFLGGSYASASKGKTSSHRGSSGRKSFHSPLGRSGGSARRSSLGKS
QSTKGPDAQNCDQGSHPLPIFGDDDHGFDMDNDDHGGTMDLCDTDADDEDDPWKPLNPYEQGKLKVKPFKKVKSLRKFGG
SLTKDHVTSMFPLAKPNGPISTELTGVWEKRRPASKDHRQPQDIPSYEKLRALLVNGGNLPTDANGNHKDSHDEANDGDF
HDFGDDHEPAFMDEDGPVMNDDGGPPDFPNYDGFGNEEDSHCQESLEDLCRSHLDALLANIAKNEKQTDLAARVSSWKQK
IEKNLEEQELHPPFDIREYGERILNKLTVEDSEHVEAFTDLMKDQEKHDVARAFSALLQLVNNGEVDLEKPGNSIGEPVC
YTAANPFSVRLLERKTEKRGMELPRKRAKSPIGKGKTHESPPPKKANTTSSVSSQRRKVPLKINSVGARCAPKGKKRGKG
RSDEVVVVGEGSEVSSVKSTVGS*

DNA
ATGACGAGCCATGGCGTCGAGAGGATTCATAGAGTACAGCCGGAGAGGGATTTGGTGGCGAATTGGGAAGTTGATTTGTC
GGAGAAGCTAGAGGAGTACCTCCTCAAAATCTGCTCCGGTGAAATCACCGGAACTGAAGAAGATTCGCCTGTCAATTTCG
CCGAAGCTGCATTGCTGCTTCAGGGCTCGGTTCAGGTGTACAGCAAGAAAGTGGAGTACTTGTACAACTTGGTCTTACGT
ACTTTGGAGTTTCTATCCAACCAAAGAGAGCAAGAAGAGTCCAAAGGTACATCAAACGAGGCTGAGGCAAGCTCCTCTCG
TCAGGTTGATGAAGAAGAAAATGATCTCTTCTGGAATGTGGATGACATCCCAGTTGACGCGAAGAATAGCTTGGACAACT
CAGTTGGTGGAGATTCATGTCCGAGTCAGTTTGTCAAGCCTCCAGCTAATCTAGTTGTACTTGAAGGTGACTGTTTGGAT
ACTAGTGGTGACGGAGGAGAATTGGAATCCTATCTGTTAGCAACTACACATCTCTACCGAGACTTTATTCTATTAGACCC
ATGTGATGCTGTAGCGGTGAATGAATTTTTAGGTGGTAGCTATGCCAGTGCCAGTAAAGGAAAGACCAGTTCTCACAGAG
GCAGCTCAGGTCGTAAAAGTTTTCACTCACCACTAGGACGTTCTGGAGGAAGTGCCCGTAGATCATCTTTGGGAAAGAGT
CAGAGCACCAAAGGTCCTGATGCTCAGAACTGTGACCAAGGCTCTCATCCTCTTCCTATCTTTGGAGATGATGATCATGG
TTTTGACATGGATAACGATGACCATGGAGGAACCATGGATTTGTGTGATACAGATGCTGATGATGAAGATGATCCGTGGA
AGCCGTTGAATCCTTATGAACAAGGGAAGTTGAAAGTGAAGCCTTTCAAAAAAGTGAAAAGTTTGAGGAAGTTCGGAGGG
AGCCTTACCAAGGACCATGTCACTTCCATGTTTCCTCTTGCTAAACCCAACGGTCCCATCAGTACAGAGCTCACCGGAGT
TTGGGAGAAGCGCCGTCCTGCTAGTAAAGATCACAGACAACCACAAGACATTCCCTCTTACGAGAAGCTTCGTGCATTGC
TAGTTAATGGAGGAAACCTACCTACTGATGCTAACGGCAATCACAAGGATAGCCATGATGAAGCTAATGATGGCGACTTC
CATGATTTTGGTGATGATCATGAACCTGCGTTCATGGATGAAGATGGTCCAGTTATGAATGATGATGGTGGACCTCCAGA
TTTCCCCAATTACGATGGATTTGGAAACGAAGAGGACTCACATTGTCAAGAAAGCTTGGAAGATCTTTGCCGCTCACACC
TGGATGCTCTTCTTGCAAACATAGCTAAAAATGAGAAGCAAACGGATCTAGCTGCTCGTGTTTCATCGTGGAAACAGAAA
ATCGAGAAAAATCTAGAAGAACAAGAGCTACACCCTCCTTTTGACATTCGAGAATACGGTGAAAGGATTCTCAACAAGCT
GACGGTTGAAGATAGTGAACACGTCGAGGCCTTTACTGATCTAATGAAAGACCAAGAAAAGCACGATGTAGCTCGAGCTT
TCTCTGCGCTTCTCCAGTTGGTGAACAATGGAGAGGTTGATCTCGAGAAACCTGGCAACTCCATAGGGGAGCCAGTGTGT
TACACAGCGGCTAATCCTTTCAGCGTTCGGTTGCTTGAAAGAAAGACTGAGAAAAGAGGAATGGAGTTACCCCGGAAACG
AGCTAAGTCCCCAATAGGCAAAGGGAAAACTCACGAGTCACCACCACCGAAGAAGGCAAACACAACGTCTTCTGTGTCAA
GCCAGAGGAGGAAAGTTCCGTTGAAGATTAACAGTGTGGGGGCAAGATGCGCTCCGAAGGGAAAGAAGAGAGGAAAAGGT
CGATCTGATGAGGTGGTAGTAGTAGGCGAGGGAAGTGAAGTTTCTTCAGTTAAAAGCACTGTGGGAAGCTGA