Details for Chinese cabbage Locus Brara.A03039

Position : A01 ( 5`- 25831534 .. 25832785 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03039

Protein [Map View]
MCGGAIISDFAPNVTKAKGRKLTAEELWSELDASAADDFWGFHSTSKTQSTNQQVTLKEEAAEKEKEKEPVTEKRRKRKN
VYRGIRKRPWGKWASEIRDPRKGARVWLGTFNTAEEAAMAYDVAAKRIRGDKAKLNFPDLLHHPPPPRSPATPLALSPVS
EVQPPAKKHCVVSQSELTQPSFPVECSGFGSGDEFQLDYDLKQQISSLESFLELDGDTVEQPSQLDESVSEVDMWMIDDV
IASYQ*

DNA
ATGTGTGGCGGTGCCATAATTTCCGATTTTGCCCCTAACGTCACCAAGGCTAAGGGTAGGAAACTCACGGCGGAGGAACT
CTGGTCAGAGCTCGATGCTTCCGCCGCCGACGATTTCTGGGGTTTCCATTCCACATCCAAGACTCAATCCACCAACCAAC
AAGTGACGTTGAAAGAGGAGGCGGCGGAGAAGGAGAAGGAGAAGGAGCCGGTGACGGAGAAACGGAGGAAGAGGAAGAAC
GTTTACAGAGGGATACGTAAGCGACCGTGGGGAAAATGGGCGTCAGAGATTCGAGATCCAAGAAAAGGCGCCAGAGTCTG
GCTCGGGACGTTCAACACGGCGGAGGAAGCCGCCATGGCTTACGACGTTGCGGCGAAGCGGATCCGCGGCGATAAAGCCA
AACTCAACTTCCCAGATCTTCTCCACCATCCTCCTCCTCCTCGTAGTCCTGCGACTCCTCTAGCATTGTCTCCAGTTTCA
GAAGTTCAGCCTCCGGCGAAGAAGCACTGCGTTGTCTCTCAGAGCGAGTTGACTCAGCCGAGTTTCCCGGTGGAGTGCAG
TGGATTCGGGAGCGGGGACGAGTTTCAACTGGACTACGATCTGAAACAGCAGATATCGAGCTTGGAGTCGTTCCTTGAGC
TGGATGGTGACACGGTGGAGCAACCGAGTCAGCTCGACGAGTCCGTCTCCGAGGTGGATATGTGGATGATTGATGATGTC
ATCGCGTCGTATCAGTAA