Details for Chinese cabbage Locus Brara.A03037

Position : A01 ( 5`- 25802859 .. 25808323 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03037

Protein [Map View]
MSSLSRELVFLILQFLDEEKFKESVHKLEQESGFYFNINMDFHPAHHTLLAVGCSSGEVSLWEVGSKEKIVTQPFKIWNM
AACTGIFQGTIVKEPSISVTRVAWSPDGNLMGVSFTKHLIHVYAYQGSELRQHLEIDAHVGCVNDLAFAHPNKQMCVVTC
GDDKLIKVWDLSGKKLYTFEGHDAQVYSICPHQKENIQFIFSTALDGKIKAWLYDNVGSRVDYDAPGQWCTTMLYSADGS
RLFSCGTSKEGDSFLVEWNESEGALKRTYQGFRKKSNGVVQFDTTRNRYLAVGEDNQVKFWDMDNTNLLTTVDAEGGLPN
LPRLRFNKEGNLLAVTTADNGFKILANADGLRTLRAYEARSYEASKASIDMKVSTSAMVSSMSPAAVGKVEHMDTDSPAR
PTPIHNGIEAMSRTMEKPRHLESVDKKPLELTEIVDPTQCRQVTMPDSKDSVSKVARLLYTNSGVGVLALGANGVQRLWK
WSRNEQNPTGKATASVTPQHWQPNSGLLMANDVPENPETAVPCIALSKNDSYVMSACGGKVSLFNMMTFKVMTTFMPPPP
ASTFLAFHPQDNNIIAIGMEDSSIHIYNVRVDEVKTKLKGHQKHITGLAFSTALNTLVSSGADAQLFFWTADSWEKKKSS
VIQLPPGKAPVGDTRVQFHNDQIHLLVSHETQLAIYDASKMECIHKWVPQEALSSPITSASYSCNSQLVYASFTDGNIAV
FDAESLRLRCRIAPSAYMPQPTPNSAPIIPQVITAHPQEPNQLAVGLSDGSVKVIEPSEASRRWGVGVAVTADKSGAENG
RPSSSSAANNSSSDHQIQR*

DNA
ATGTCGTCTCTGAGCAGAGAGTTAGTGTTCTTGATCCTTCAGTTCTTAGACGAAGAGAAGTTCAAAGAATCTGTTCACAA
GCTAGAGCAGGAATCTGGGTTCTACTTTAATATAAACATGGATTTTCACCCTGCGCATCACACTTTACTCGCTGTTGGTT
GTTCAAGCGGCGAAGTCAGCTTGTGGGAAGTTGGATCCAAAGAGAAGATTGTCACACAGCCTTTTAAGATATGGAATATG
GCCGCCTGCACTGGGATCTTCCAGGGTACTATTGTCAAAGAACCATCGATATCTGTCACTCGTGTAGCTTGGAGCCCTGA
TGGAAATTTGATGGGAGTTTCTTTTACTAAACATTTGATCCATGTATATGCCTACCAAGGCTCGGAACTACGCCAACACC
TTGAGATTGATGCTCATGTAGGCTGTGTAAATGACTTGGCGTTCGCCCACCCAAACAAGCAAATGTGTGTTGTGACTTGT
GGAGATGACAAATTGATTAAGGTGTGGGATCTGAGTGGGAAGAAGCTTTACACCTTTGAAGGCCATGATGCTCAGGTTTA
CTCCATCTGCCCTCACCAGAAGGAGAACATTCAGTTTATATTCTCAACTGCTCTTGACGGTAAGATCAAGGCTTGGCTCT
ATGATAACGTTGGTTCTCGAGTTGATTACGACGCGCCAGGACAGTGGTGTACAACGATGCTATACAGTGCTGATGGTAGC
AGGTTATTTTCTTGTGGAACGAGCAAAGAGGGAGACTCTTTCCTTGTCGAGTGGAATGAGAGCGAAGGTGCCCTGAAGAG
AACATATCAAGGCTTCAGGAAGAAATCTAATGGAGTTGTTCAGTTTGATACAACTCGTAACCGTTACTTAGCTGTTGGTG
AAGACAATCAAGTCAAATTCTGGGACATGGACAATACAAATCTCTTGACAACCGTTGACGCTGAAGGAGGACTTCCTAAT
CTTCCTCGTTTGAGGTTCAACAAGGAAGGGAACCTTCTTGCGGTGACTACAGCGGATAATGGATTCAAGATCCTTGCAAA
TGCTGATGGTCTTAGAACGTTGAGAGCTTATGAAGCTCGGTCTTATGAAGCATCTAAAGCATCCATTGATATGAAGGTAT
CAACTTCCGCAATGGTTTCAAGCATGAGTCCAGCAGCTGTTGGTAAAGTTGAACACATGGACACAGACTCTCCTGCTAGG
CCAACTCCAATTCATAATGGAATTGAGGCAATGTCAAGAACTATGGAGAAGCCAAGACACTTGGAATCTGTTGATAAGAA
ACCCTTGGAGTTAACAGAGATTGTTGATCCTACTCAGTGCCGACAAGTGACCATGCCAGATAGCAAGGATTCTGTCAGCA
AGGTTGCTCGGCTTCTTTATACAAACTCTGGTGTTGGCGTCCTTGCTCTGGGAGCAAATGGTGTCCAAAGACTATGGAAG
TGGAGCCGCAATGAGCAGAATCCAACAGGGAAGGCAACGGCAAGTGTAACTCCACAGCATTGGCAGCCAAACAGTGGTCT
CCTAATGGCAAACGATGTTCCTGAGAATCCTGAAACAGCTGTGCCATGTATAGCGCTTTCTAAGAATGACTCATATGTCA
TGTCAGCGTGTGGTGGAAAGGTTTCTTTATTCAATATGATGACTTTCAAAGTGATGACAACTTTCATGCCACCACCACCA
GCTTCAACATTCCTGGCGTTTCATCCTCAAGATAATAACATTATTGCAATTGGAATGGAAGACTCTAGTATCCATATTTA
CAATGTCAGGGTAGATGAGGTGAAAACAAAGTTGAAAGGTCACCAGAAGCATATAACTGGTCTTGCTTTCTCCACTGCAC
TCAATACACTTGTCTCTTCTGGTGCTGATGCTCAGCTATTCTTCTGGACCGCTGACTCATGGGAGAAGAAGAAATCTTCA
GTGATTCAACTACCACCTGGTAAAGCACCAGTGGGAGACACAAGAGTCCAGTTCCATAACGACCAAATCCATTTATTGGT
TTCACATGAGACGCAGCTTGCTATTTATGATGCTTCAAAGATGGAATGTATACATAAGTGGGTGCCACAAGAAGCTCTCT
CTTCCCCCATTACCTCTGCATCTTACTCATGCAACAGCCAGCTGGTTTACGCATCATTCACTGATGGAAACATTGCAGTC
TTTGATGCTGAATCCTTGAGACTCAGATGTCGCATTGCTCCATCTGCTTACATGCCTCAACCGACACCCAACAGTGCACC
AATCATTCCACAAGTGATCACAGCTCATCCACAAGAACCGAACCAACTAGCCGTTGGACTCTCTGATGGTTCAGTTAAAG
TGATTGAGCCATCAGAAGCATCTAGAAGATGGGGCGTAGGGGTCGCAGTTACTGCAGATAAATCAGGAGCCGAGAATGGA
CGGCCATCGAGTTCCTCTGCAGCTAATAACTCAAGTTCAGATCATCAGATTCAAAGGTGA