Details for Chinese cabbage Locus Brara.A03036

Position : A01 ( 5`- 25784979 .. 25789748 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03036

Protein [Map View]
MSKLLKSTATMSPGGGESSSMAAKKKNKRSHKRKREEELERLDSLPWSSTIPIGEDDEGETFSTLFAGSDELDGGFLSLE
EIDEADYNLADFPVDESVKGKKGLKSKKQAHDNNDGDEEEAVDEITEDKVGEEEGKGEGVVESPKKKEKKYKNKKKKERR
KRVKEADKVQDSPAAVSCDEENKAEELDGEEEEIPPEFSAWSLMRLHPLLMKSIYHLGFKEPTKIQKACFTVAAFQGKDV
IGAAETGSGKTLAFGLPILQRLLDEREKVGKLFALKGEEAQKYSADGYLRALIITPTRELALQVTEHLKNAAKNLGVRVV
PIVGGMSSAKQERLLKGKPEIVVGTPGRLWELMSAGEKHLVELQCLSFFVLDEADRMVEGGHFRELQSIIDMLPVTDKPS
EGKTQSSDTVSDAPKKKRQTFVFSATIALSSDFRKKLKRGSSKSKQSSSGEVNSIEVLSERAGMRDSVAIVDLTTAAILA
PKIEESFIRCEEEDKDAYLYYLLSVHGQGRTIVFCTSVAALRHICALLKILGVDVCKLNADMKQQARLKAMDRFRSSENG
VLVATDVVARGIDIKNVRTIIHYQLPHSAEVYVHRSGRTARAFADGCSIALIAPNDTSKFYTLCKSFSKESVKIFPLDSS
LMPDVKKRLSLARQIDQIERKGSRERVDRTWLEKHAELMELELDEDESEEEKVDNVRQRKATSAQLKKLKEELSSLLSRP
MQPKKFSDRYFAGRGMSPLLQNQLAELTNQKQQQQVASGGDKKRRKLVVVSQNCIEPLQALRDGSKEVMSMKGQSADRRR
DIATLRKKKKEEKIGRRDQRRDQKKKRKLMAS*

DNA
ATGTCGAAGCTTCTCAAATCAACGGCTACCATGTCTCCCGGCGGTGGAGAATCATCCTCAATGGCGGCGAAGAAGAAGAA
CAAAAGAAGTCATAAGAGGAAGCGAGAAGAAGAGCTCGAACGCTTGGATTCGCTTCCGTGGAGCTCTACTATACCTATCG
GAGAAGACGACGAAGGCGAAACGTTCTCCACCCTCTTCGCGGGTTCAGACGAGCTTGACGGAGGTTTTCTTTCGCTTGAA
GAAATTGATGAAGCTGATTACAATCTTGCGGACTTTCCTGTGGATGAAAGTGTGAAAGGAAAGAAAGGGTTGAAGTCGAA
GAAGCAAGCTCATGATAATAATGATGGTGACGAAGAAGAGGCTGTGGATGAGATAACTGAAGATAAAGTAGGAGAAGAAG
AAGGTAAAGGAGAGGGTGTTGTGGAGAGTCCTAAGAAAAAAGAGAAGAAATATAAAAATAAGAAGAAGAAGGAGAGGAGG
AAGAGGGTTAAGGAGGCTGATAAGGTTCAGGATTCTCCTGCTGCCGTTAGCTGTGATGAGGAGAACAAAGCAGAGGAGCT
AGATGGTGAAGAAGAAGAGATTCCCCCGGAGTTTAGTGCATGGAGTTTGATGAGACTCCATCCACTACTCATGAAGTCTA
TATACCATCTCGGATTCAAGGAGCCGACAAAAATCCAGAAGGCTTGTTTTACCGTTGCAGCGTTTCAGGGAAAGGATGTT
ATTGGTGCCGCGGAGACAGGGTCTGGAAAGACGCTTGCTTTTGGGTTGCCCATACTCCAACGCCTCTTAGATGAGCGGGA
GAAGGTTGGCAAATTGTTTGCATTGAAGGGAGAGGAAGCGCAGAAATATTCTGCAGATGGCTACTTACGAGCTCTTATCA
TCACTCCGACTAGGGAACTTGCTCTACAGGTGACAGAACATCTTAAGAACGCTGCCAAAAATCTAGGTGTCAGGGTCGTT
CCTATTGTTGGTGGGATGTCATCAGCGAAGCAGGAAAGGCTTCTGAAAGGAAAACCAGAAATAGTTGTTGGAACTCCGGG
GAGGTTATGGGAACTCATGTCGGCCGGAGAAAAGCATCTTGTAGAGCTGCAATGCTTGTCGTTCTTTGTGTTGGATGAGG
CTGACCGCATGGTTGAAGGCGGGCATTTCCGGGAGCTGCAGTCTATAATTGACATGCTTCCAGTGACAGATAAACCAAGC
GAAGGGAAAACGCAGAGTTCCGATACAGTTTCAGACGCCCCAAAGAAGAAAAGACAAACATTTGTTTTCTCAGCTACCAT
AGCACTGTCCTCTGACTTCCGCAAAAAGCTAAAGCGCGGCTCCTCCAAGTCAAAGCAGTCATCGTCTGGTGAAGTAAATT
CCATTGAGGTTTTATCTGAAAGAGCTGGAATGAGAGATAGTGTTGCCATCGTTGATCTGACGACTGCTGCTATTTTGGCA
CCAAAGATTGAAGAATCTTTTATTAGGTGCGAAGAGGAGGATAAAGATGCGTACTTGTATTATCTTCTGAGCGTCCATGG
ACAAGGGCGGACAATTGTTTTCTGTACATCAGTGGCAGCTTTGCGTCATATCTGTGCGCTTCTAAAGATTCTTGGAGTCG
ATGTTTGCAAACTCAACGCAGATATGAAGCAGCAAGCTCGGTTGAAGGCAATGGACCGTTTCCGTTCAAGCGAAAATGGA
GTACTCGTGGCAACAGATGTTGTAGCAAGGGGAATTGATATTAAGAATGTCCGAACTATTATTCACTACCAGCTTCCACA
TTCAGCAGAAGTTTATGTTCATAGAAGTGGAAGGACGGCTAGAGCATTCGCAGATGGATGCAGCATAGCTTTAATTGCTC
CGAATGATACATCAAAGTTTTACACGCTATGCAAGTCATTCTCTAAGGAAAGCGTAAAGATATTCCCTTTGGATAGCTCC
CTAATGCCAGATGTGAAGAAGCGGTTGTCTCTAGCACGTCAAATAGACCAGATTGAGCGAAAAGGGTCGCGGGAGAGAGT
AGACAGGACCTGGCTCGAGAAACATGCTGAGTTGATGGAACTGGAGTTGGACGAAGATGAAAGCGAAGAGGAAAAAGTAG
ACAATGTTAGGCAGAGGAAAGCGACCTCAGCACAACTTAAAAAGCTGAAGGAGGAACTTAGCTCGCTATTATCACGTCCG
ATGCAGCCTAAGAAATTTTCAGACCGTTACTTTGCTGGGCGTGGTATGTCGCCACTATTACAGAATCAGCTAGCAGAGTT
AACAAATCAGAAGCAGCAGCAACAAGTGGCAAGTGGTGGAGATAAAAAGAGAAGAAAGCTTGTGGTGGTTTCCCAGAATT
GCATCGAACCTCTTCAAGCCCTTCGTGACGGTAGTAAAGAGGTGATGAGCATGAAAGGTCAGAGTGCAGATAGGAGACGC
GATATAGCTACATTGAGGAAGAAGAAAAAGGAAGAGAAGATAGGTCGGCGTGATCAGCGAAGGGATCAGAAGAAGAAGAG
AAAACTAATGGCTTCTTAA