Details for Chinese cabbage Locus Brara.A03034

Position : A01 ( 5`- 25772102 .. 25772997 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03034

Protein [Map View]
MSEGSEETKTKVDSAGELSDVDNENCSSSGSGGGETKKTCVDCGTFKTPLWRGGPAGPKSLCNDCGIKSRKKRQAALGIK
PEKKIRKSNSCDSDLSLEDDRNVNNKIKKADDHTSTSSSCSKRVSKFLDLGLEVPVMKRSAVEKKRLWKKLGEEERAAVL
LMALSCGSVYA*

DNA
ATGTCGGAGGGATCAGAAGAAACGAAGACAAAGGTTGATTCCGCCGGAGAGTTATCGGACGTCGATAACGAGAACTGTAG
TAGCAGTGGAAGTGGCGGCGGCGAGACGAAGAAGACATGCGTTGATTGCGGAACGTTCAAAACTCCTCTCTGGCGCGGTG
GCCCTGCCGGACCTAAGTCGCTGTGCAATGATTGTGGGATCAAGAGCAGGAAGAAGAGGCAAGCGGCTCTCGGGATCAAA
CCAGAGAAGAAGATCAGAAAAAGCAACAGCTGTGACAGTGATCTAAGCCTCGAAGATGATCGTAATGTCAATAACAAGAT
CAAGAAAGCTGATGATCATACTAGTACTAGTAGCAGCTGCAGCAAAAGAGTGAGTAAGTTTCTGGATCTGGGATTGGAAG
TGCCGGTGATGAAGAGATCAGCGGTTGAGAAGAAGAGGCTGTGGAAGAAACTCGGCGAGGAAGAAAGAGCCGCTGTGCTT
CTCATGGCGCTCTCTTGCGGCTCTGTTTATGCGTAA