Details for Chinese cabbage Locus Brara.A03033

Position : A01 ( 5`- 25749760 .. 25752140 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03033

Protein [Map View]
MRGGFASSSSRAAAAAAAAKPSESLNPKPLFSSGKPTNPIDQRHISQIIRRKDWFLILNQSLTSHRINLNPRFIISLLQN
QDNPLHSLRVYLWVSNTNPVYSKDQSLKTVLGNALFRKGPLLLSKELLKEVRDSGFRISDELMCVLIGSWGKLGLAKYCN
DVFAEISLLGMKPSTRLYNAVIDALVKSNSLDLAYLKFHQMRGDGCEPDRFTYNILVHGVCKKGVVDEAVRLVKQMEKEG
SYRANVFTYTILIDGFLRLGRVEEALKQFETMQARKMSPNEATIRTLVHGVFRCLPKCEAFEVLLEFMEKDSSLQRVGYD
TVLCCLSSNSMAKETALFLRKTGYVPDSLTFNAAMSCLLKGFDLAETCGIFDGFVRRGVKPGFNGYLAVVQALLNAHRFS
EGDLYLKQMCVEGLITSVYDYNAVIDSLCKARRTERAAMYLTEMQGRGIPPSLVTFNTLLSGYSSRGDVKKVREVVEKLL
DHGCKPDVITFSSVINCLCRAKEIKDAFECFKEMLEWGIEPNEITYNILIRASCSVGDTGRSVKLFAEMKEKGLSPDVYA
YNAVIQSFCRMRKVERGEELFETMLRVGLKPDNYTYSCLIKALSECGRESEAREVFSLMERHGCVPDSYTKRVVEELGLR
MSGLERETVSAS*

DNA
ATGAGAGGAGGCTTTGCTTCTTCATCTTCCAGAGCAGCGGCGGCGGCGGCAGCAGCAAAACCATCCGAATCCCTAAATCC
AAAACCCTTATTCTCCTCAGGTAAACCCACAAACCCAATCGACCAGCGTCACATCTCCCAAATCATCCGACGAAAAGACT
GGTTCTTGATCCTGAACCAATCCCTCACTTCCCATCGAATCAATCTAAACCCTCGATTCATCATCAGCCTCTTGCAGAAC
CAAGACAACCCTTTACACTCCCTCCGCGTCTACCTCTGGGTCTCCAACACAAACCCGGTTTACTCCAAGGACCAGTCTTT
GAAAACCGTTCTAGGGAATGCTCTGTTCCGTAAAGGCCCTCTCTTGCTCTCCAAGGAGCTTCTCAAGGAGGTTCGAGACT
CAGGGTTTAGGATTAGTGATGAGCTGATGTGTGTTTTGATCGGGAGCTGGGGGAAGTTGGGTTTAGCTAAGTACTGTAAC
GATGTCTTTGCGGAGATATCTCTCCTTGGGATGAAGCCAAGCACGAGGCTTTACAACGCTGTGATCGATGCTTTGGTGAA
GTCCAACTCTCTTGACTTGGCTTACTTGAAGTTTCACCAGATGCGTGGGGACGGTTGTGAACCGGACCGGTTTACTTATA
ATATACTTGTGCACGGTGTTTGCAAGAAAGGTGTGGTTGATGAGGCGGTGAGGTTGGTTAAGCAGATGGAAAAGGAAGGG
AGCTACAGGGCGAATGTGTTCACGTACACGATTTTGATCGATGGGTTTTTGAGGTTGGGGAGGGTTGAGGAGGCGTTGAA
GCAGTTTGAGACTATGCAAGCGAGGAAGATGAGTCCTAACGAAGCTACAATACGGACTCTGGTTCATGGGGTTTTCCGTT
GCTTGCCCAAGTGTGAAGCTTTTGAGGTTCTGCTTGAGTTTATGGAGAAGGACTCGAGCTTGCAGAGAGTGGGGTATGAT
ACTGTGTTGTGTTGTCTTTCGAGTAACTCAATGGCGAAAGAGACTGCTTTGTTTTTGAGGAAGACAGGTTATGTGCCGGA
TAGCTTAACGTTTAATGCTGCAATGAGTTGTCTTTTGAAAGGGTTTGATCTTGCTGAGACGTGTGGGATTTTCGACGGTT
TTGTAAGGAGAGGAGTTAAGCCAGGGTTCAACGGCTATCTTGCGGTGGTTCAAGCTCTGTTGAATGCTCATAGGTTCTCT
GAAGGTGACCTGTATCTGAAACAGATGTGTGTTGAGGGGCTTATAACAAGCGTATATGATTATAACGCGGTGATAGACTC
TCTCTGCAAGGCTAGACGTACAGAGCGTGCGGCTATGTACTTAACAGAGATGCAGGGTAGAGGTATTCCTCCGAGTCTTG
TAACTTTCAACACTCTTCTCAGCGGGTATAGCTCAAGGGGAGATGTGAAGAAGGTTCGAGAAGTGGTGGAGAAGCTTCTG
GACCATGGTTGTAAACCAGACGTGATCACTTTCAGTTCGGTTATTAACTGTCTTTGTCGTGCTAAGGAGATAAAAGATGC
GTTTGAGTGTTTCAAGGAGATGTTGGAATGGGGGATTGAGCCGAATGAGATTACGTATAATATTCTAATTCGCGCGTCTT
GCTCCGTGGGGGATACTGGTAGATCAGTGAAGCTGTTTGCGGAGATGAAGGAGAAGGGGTTGAGTCCAGATGTTTATGCG
TACAATGCGGTTATTCAGAGTTTTTGTAGGATGAGGAAGGTAGAGAGAGGTGAGGAGTTGTTTGAAACGATGTTGAGGGT
TGGTTTGAAACCAGATAACTATACGTATAGTTGTCTTATTAAAGCGCTAAGTGAATGTGGTAGAGAGAGTGAAGCAAGAG
AGGTGTTTAGTTTGATGGAGAGGCATGGGTGTGTACCGGATTCGTATACTAAGCGTGTTGTTGAAGAACTTGGCCTGAGA
ATGAGTGGACTCGAGAGAGAAACAGTGTCAGCCTCGTAG