Details for Chinese cabbage Locus Brara.A03032

Position : A01 ( 5`- 25746473 .. 25747221 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03032

Protein [Map View]
MAEQDLNNRSNTIPIIGSEFVRPQPSDLTIVGDTVKDANGNKVFKVKTPLFGLHNKRILLDPNDSPIVTMKMKVTSKHDR
WQVYRGGDLDDKIFTVKRSSSVQLKTRVEVFLKHNQTKEASCDFTIKGRFMKRACTIYVGDSTKVIAQVHEGEERLVATV
YPNVDCAFIVTLIFIFDLINMAGTGV*

DNA
ATGGCAGAACAAGATCTCAACAACAGGAGCAACACGATACCAATCATAGGATCTGAGTTTGTTCGTCCTCAGCCTTCAGA
TCTTACCATCGTCGGAGACACGGTGAAGGATGCCAACGGAAACAAAGTATTCAAAGTCAAAACGCCTCTCTTCGGTCTCC
ACAACAAGAGGATTTTGCTTGATCCTAACGACTCTCCCATCGTCACCATGAAAATGAAGGTGACTAGTAAGCACGATCGA
TGGCAAGTGTATAGAGGAGGTGATTTAGATGATAAGATATTCACGGTTAAAAGATCCTCATCGGTCCAACTAAAAACAAG
AGTTGAAGTATTCTTGAAACATAACCAGACCAAAGAAGCGTCTTGTGATTTCACTATTAAAGGTCGGTTTATGAAGCGTG
CATGCACAATCTATGTTGGAGATTCAACGAAAGTAATCGCTCAGGTACATGAAGGAGAAGAGAGACTAGTGGCTACAGTT
TACCCTAATGTCGACTGCGCTTTTATTGTTACACTTATCTTTATATTTGACCTCATTAATATGGCTGGAACTGGGGTCTG
A