Details for Chinese cabbage Locus Brara.A03028

Position : A01 ( 5`- 25736375 .. 25738423 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03028

Protein [Map View]
MADEKYNRKNPAVKRILQEVKEMQANPSDDFMSLPLEENIFEWQFAIRGPADTEFEGGIYHGRIQLPADYPFKPPSFMLL
TPNGRFETNTKICLSISNYHPEHWQPSWSVRTALVALIAFMPTSPNGALGSVEYPKEERRTLAIKSREAPPKYGSPERQK
VIDEIHHYILSKATVVSKPLPLECNQTASTESVAHSQTEPQEAITVVEEPSIVTVDNIADDRIIEEAAEAVNREANASPT
AGALATVEVAAKASGSGEQTMVRRAAQKPVDDRLFTLAAVGLAIAIVVLLLKKFIRSSGYGTGFMDQS*

DNA
ATGGCGGATGAGAAGTATAACCGGAAGAATCCAGCCGTGAAGAGGATTCTGCAGGAGGTTAAGGAGATGCAAGCTAATCC
GTCTGATGATTTCATGTCTCTCCCCCTTGAGGAGAACATCTTTGAGTGGCAATTCGCCATCAGAGGACCTGCTGATACTG
AATTTGAAGGTGGGATTTATCATGGGAGGATTCAGCTGCCTGCAGATTACCCTTTCAAACCTCCTTCCTTCATGTTATTG
ACTCCTAACGGTCGTTTTGAAACCAATACCAAGATTTGCTTGAGCATTTCGAATTACCATCCTGAGCACTGGCAACCTTC
ATGGAGTGTTCGCACTGCTTTGGTGGCTCTCATTGCCTTCATGCCTACTAGCCCCAACGGAGCACTGGGATCAGTAGAGT
ATCCAAAAGAAGAGAGGCGTACACTAGCCATTAAATCACGTGAGGCACCGCCCAAGTATGGCTCTCCTGAACGTCAGAAA
GTTATTGATGAGATTCATCACTACATTCTTAGCAAAGCGACTGTGGTTTCAAAACCTCTTCCTCTGGAATGTAACCAAAC
TGCTTCCACTGAATCAGTAGCTCATTCCCAAACTGAGCCACAGGAAGCCATAACAGTAGTGGAAGAACCATCCATCGTCA
CAGTAGACAACATAGCTGATGATCGAATAATCGAAGAAGCAGCTGAAGCAGTCAATAGAGAGGCTAATGCGAGTCCTACA
GCAGGAGCGTTAGCAACGGTTGAGGTTGCGGCAAAAGCTTCTGGAAGTGGTGAGCAGACAATGGTAAGAAGAGCGGCTCA
GAAGCCAGTCGATGACAGACTGTTCACGTTGGCGGCGGTTGGGCTCGCAATAGCAATCGTGGTTCTTCTCCTAAAAAAGT
TCATAAGGTCAAGTGGTTATGGTACTGGCTTTATGGACCAGTCTTGA