Details for Chinese cabbage Locus Brara.A03027

Position : A01 ( 5`- 25734818 .. 25736099 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03027

Protein [Map View]
MAESNGRRIGVAVDFSECSKKALNWAIENVARDGDYLILITVAHDMHYEDGEMQLWETVGSPLIPLSEFSEAAVMKKYGV
KPDAETLDIANTAARQKSITVVMKIYWGDPREKICEAAEHIPLSSLVIGNRGLGGLKRMIMGSVSNHVVNNVACPVTVVK
AHH*

DNA
ATGGCGGAGAGTAATGGTCGGAGGATCGGAGTAGCGGTGGATTTCTCGGAGTGCAGCAAGAAGGCTCTGAACTGGGCGAT
CGAGAACGTGGCTCGCGACGGAGATTATCTAATCCTCATCACCGTCGCTCACGATATGCATTACGAGGATGGCGAGATGC
AGCTCTGGGAGACCGTTGGATCTCCTCTGATTCCGCTGAGTGAGTTCTCGGAAGCTGCTGTGATGAAGAAGTATGGAGTG
AAGCCTGATGCTGAAACCCTTGACATTGCCAACACTGCCGCTAGGCAGAAATCTATTACAGTAGTGATGAAGATATATTG
GGGAGATCCTCGTGAGAAGATATGTGAAGCTGCTGAACATATCCCTCTCTCTAGCCTTGTCATCGGTAACCGTGGCCTTG
GTGGCCTTAAGAGGATGATAATGGGAAGTGTAAGCAACCATGTTGTGAACAACGTGGCATGCCCTGTCACCGTCGTGAAG
GCTCACCACTGA