Details for Chinese cabbage Locus Brara.A03026

Position : A01 ( 5`- 25730710 .. 25734180 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03026

Protein [Map View]
MGDSIGDSLIEIDDKEEVEDPFLAFVDYARAVISPEQDEIEEEEEDVRKKNPSEAVTEVSGPGWGWIASRLLKTCTAYSS
GVTAAILLSDLSQGWHEQNKPGMSKKKPELIDQLNKSHRRKRLANTVTIDSIYEKNFLSMNSVLEAVVIKADLLPGTNIF
MLTLGDFWSSNTIDLYLHRRYYELVETPNGILRKGREVLITGCYLRTAREGCGTPRLLPTEYLVILLDEDEEEDAIFIVA
QLCSDTFSSVSLDDFNNGTSYSLYARIESIGPLESELKFSTAHRRQIALVDADGVKLKFILWGDQVIVANLMSVGSMLGL
ERPYISSLEESAMEGKDEFCLEYGSATHLYIVPSTLQEETVCVSLSQNQCQGSKLLGSVGVSQVTLPRDAKGSIDFSNYP
FRTNITDCRDKTTGISLYGVVTDILCDPNATGVVFSLKIEDTTGAIWARLHFNSYWSLGRLGLGHVVYVSGLSCKTTKEN
CLEVLWHEGNEKATFINLSCLPAFLTSSCLHKVSTLSQISKQRKPAINICRVKLDEIDQCHSINTRLSHSVCGHFIDEES
PLHGGNLHCSFCRVTFNSNGGSEVVRTFHIMITLADDETTKLYAWCTGQSASAILQISPDEFCDLPEDDQLMYPSSLENE
WFLVTLANSGGRSLSHKMEATCWEITRALKI*

DNA
ATGGGGGATTCAATCGGAGACTCGCTAATTGAAATCGACGACAAGGAAGAAGTCGAAGACCCGTTTCTAGCCTTCGTCGA
CTACGCCAGAGCGGTGATTTCACCGGAACAAGACGAAATCGAGGAGGAGGAGGAGGATGTGAGGAAGAAGAATCCAAGCG
AAGCCGTGACTGAGGTGAGCGGTCCAGGCTGGGGATGGATTGCCTCGCGTCTATTGAAAACATGCACTGCTTATTCGAGC
GGTGTCACTGCCGCCATTCTCCTCTCAGATCTCTCTCAGGGGTGGCATGAGCAAAACAAACCGGGGATGTCAAAGAAGAA
GCCTGAGCTCATTGATCAGTTGAATAAGAGTCATAGAAGAAAAAGACTCGCTAATACTGTTACTATAGACTCTATTTACG
AGAAGAATTTTCTGTCTATGAATAGTGTTTTGGAAGCTGTTGTTATCAAGGCTGATCTCCTCCCTGGTACAAACATATTC
ATGCTTACGCTAGGGGATTTTTGGAGCTCCAACACTATTGATCTCTATCTACATCGCAGGTATTATGAGTTGGTGGAAAC
ACCAAATGGGATACTTAGGAAAGGCAGAGAGGTTTTGATCACTGGATGCTACCTTCGTACCGCTAGAGAAGGATGTGGTA
CTCCACGGTTACTTCCAACAGAGTATCTTGTCATTTTGCTAGATGAGGACGAAGAAGAAGATGCAATCTTTATTGTAGCT
CAACTTTGTTCCGATACTTTCTCATCTGTTTCTCTTGATGATTTCAACAATGGAACTTCATACTCTTTGTATGCTAGGAT
TGAATCTATAGGTCCTCTGGAATCTGAACTCAAGTTTAGTACTGCGCATAGAAGGCAAATTGCACTTGTAGATGCTGACG
GCGTTAAGTTAAAATTTATCTTGTGGGGAGATCAAGTCATCGTGGCAAACCTCATGAGTGTGGGAAGTATGCTTGGGCTT
GAGAGGCCTTATATTTCTAGTCTCGAAGAGAGTGCAATGGAAGGAAAAGATGAGTTCTGCCTCGAATATGGTAGCGCAAC
ACATCTCTATATAGTGCCGTCAACCTTACAAGAGGAAACGGTTTGTGTATCTTTATCCCAGAATCAGTGTCAAGGATCTA
AACTGCTTGGTTCAGTAGGAGTTTCGCAGGTGACATTGCCTCGTGACGCCAAAGGGTCTATAGACTTCAGCAATTATCCT
TTTCGGACGAATATAACGGACTGTCGCGACAAAACCACTGGCATCAGTCTCTATGGCGTTGTAACAGATATATTATGTGA
TCCAAATGCCACAGGAGTGGTCTTCTCTTTGAAAATCGAGGACACAACCGGAGCAATATGGGCTAGGCTCCACTTTAATA
GTTACTGGTCGTTGGGAAGGTTAGGACTTGGTCATGTCGTATACGTTTCAGGGTTATCCTGCAAAACCACAAAAGAGAAT
TGCCTTGAGGTGTTATGGCATGAGGGGAACGAGAAAGCTACATTCATCAACCTAAGCTGCTTACCTGCATTTCTAACCTC
TTCTTGTCTTCACAAAGTCTCTACCCTCTCCCAAATTTCAAAACAGAGAAAACCTGCAATCAACATTTGTCGGGTGAAGC
TGGATGAGATTGACCAATGCCATAGCATAAACACGAGATTATCACACAGCGTTTGCGGCCATTTCATAGACGAAGAATCG
CCACTACACGGAGGGAATCTGCATTGTAGCTTCTGCCGGGTAACCTTTAATAGTAACGGAGGATCAGAGGTAGTGAGAAC
GTTCCACATAATGATAACACTTGCAGACGACGAAACCACCAAACTGTACGCATGGTGTACGGGTCAGTCAGCATCAGCTA
TACTTCAGATATCTCCTGACGAATTCTGTGATCTCCCTGAGGATGATCAGCTAATGTATCCATCTTCATTGGAGAACGAG
TGGTTCCTAGTGACCTTAGCTAACAGCGGTGGCCGGAGTTTGTCTCATAAAATGGAGGCGACTTGCTGGGAAATCACCCG
CGCTCTCAAGATTTAA