Details for Chinese cabbage Locus Brara.A03024

Position : A01 ( 5`- 25718209 .. 25718857 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03024

Protein [Map View]
MSVTSKNCEIFVVSDKRVKPYGSITAHHRENADENTGYVFIRGKVYGIDDVYLGRAKGPYSRVIFAKTYLSKTVVPNGWT
NWSYDGSTKDLYHAEYKCPGPGADRQQDESFLSIDFIDGTYWLPVLLQQAS*

DNA
ATGAGTGTTACATCCAAGAACTGTGAGATCTTTGTGGTATCGGACAAGAGGGTGAAACCATACGGATCAATCACAGCACA
CCACAGAGAAAACGCAGACGAAAACACGGGTTATGTGTTCATAAGAGGAAAAGTGTATGGAATCGACGACGTTTACTTAG
GCCGAGCCAAAGGACCTTATTCTCGAGTCATCTTTGCCAAGACTTACTTGTCCAAGACCGTTGTCCCTAACGGTTGGACT
AACTGGAGCTACGACGGCTCGACCAAGGATTTATACCATGCGGAGTATAAGTGTCCTGGACCAGGTGCTGATAGACAACA
AGATGAGTCTTTCTTGTCCATTGATTTTATTGATGGAACTTATTGGCTCCCTGTTTTGCTTCAGCAAGCGTCTTAG