Details for Chinese cabbage Locus Brara.A03020

Position : A01 ( 5`- 25696731 .. 25697939 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03020

Protein [Map View]
MNSTSNQLLQPTTSSTSDLSRRKRKTKSPPLVPPSPSTKWRSEKQQQIYTTKLARALTKLRIAQPSSSHSSPPHGGRAVR
EVADRALAVTARGKTRWSRAILSKAVKLKLRKHKRQRIYNSVTSPAITTGSLRSKTQTATVTRVKAKGMPSVQRKVRVLS
RLVPGCRKQTLPVVLEETTDYIAAMEMQIRAMTAILSAVSSPTGHEGGQTHVLG*

DNA
ATGAACTCCACGTCGAATCAGTTACTTCAGCCGACGACGAGCTCTACCTCCGACCTCTCTCGCCGGAAACGGAAGACAAA
ATCGCCGCCGCTGGTACCTCCCTCTCCATCGACGAAATGGAGATCGGAGAAGCAGCAACAGATCTACACCACGAAGCTTG
CACGTGCCCTAACAAAGCTTCGAATCGCTCAACCATCCTCCTCACACTCTTCGCCTCCTCACGGCGGCAGAGCCGTCCGC
GAAGTCGCCGACAGAGCCTTGGCGGTTACGGCAAGAGGCAAAACACGGTGGAGCCGAGCGATACTATCCAAAGCCGTTAA
ACTCAAACTCAGGAAACACAAACGTCAGAGAATCTATAATTCGGTTACGTCTCCGGCAATCACCACCGGGAGTCTCCGGT
CAAAGACACAGACAGCGACGGTTACGAGGGTTAAAGCTAAAGGTATGCCGTCTGTACAGAGGAAGGTGAGAGTGCTGAGC
CGGTTAGTTCCGGGTTGCCGTAAACAGACGTTACCGGTGGTTTTGGAAGAAACGACGGATTATATAGCTGCCATGGAGAT
GCAGATTCGCGCCATGACGGCTATTCTCTCCGCCGTCAGCTCTCCGACAGGTCATGAAGGGGGACAAACACATGTGCTTG
GTTAG