Details for Chinese cabbage Locus Brara.A03018

Position : A01 ( 5`- 25629281 .. 25630098 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03018

Protein [Map View]
MKNSSAVTSPLSLSLFLLFLLPFLAQSSDDLIDTICKATPFFDLCEASLRPLSPSPPDTKSIASAMANVVLGNMTDTLGY
IQSLIRHSQDPAAERALAQCAELYRPVVRFNIPQAIEAMGRGEFGFAMYVLGDAQKQSDSCQKWINSAGADDESSVPLTA
RNKLVKNLCDVEISVIKSIMNGR*

DNA
ATGAAAAACTCCTCCGCCGTCACATCACCACTGTCTCTCTCCCTCTTCCTCCTCTTCCTCCTACCGTTTCTAGCTCAATC
CTCCGATGATCTGATCGACACGATCTGCAAAGCGACACCATTCTTTGACCTCTGTGAAGCTTCTCTCCGCCCTCTCTCTC
CCTCACCTCCCGATACCAAGTCTATAGCTTCCGCAATGGCCAACGTTGTGCTCGGAAACATGACCGATACCTTAGGATAT
ATTCAATCACTCATCAGACATTCTCAAGATCCGGCCGCGGAACGAGCGCTGGCTCAGTGCGCCGAGTTGTACCGGCCGGT
GGTCCGGTTCAACATTCCTCAGGCCATCGAAGCAATGGGGCGAGGGGAGTTCGGATTCGCGATGTATGTCCTCGGAGACG
CCCAGAAACAGTCTGATTCTTGTCAGAAATGGATCAATAGTGCCGGCGCCGACGATGAAAGCTCGGTACCTCTTACGGCT
AGAAACAAGCTGGTTAAGAATCTTTGTGACGTGGAGATATCTGTGATTAAGTCTATAATGAATGGTCGTTAA