Details for Chinese cabbage Locus Brara.A03016

Position : A01 ( 5`- 25623553 .. 25624246 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03016

Protein [Map View]
MINFMKLFSIFLFIQIQIALSQPNLIQQLCKRNRYQPLCVSTLNLDPRSKTSDLQGLASISIDATTKKTNDTLTYLISEL
RRTGGDRTAFEKYGTCVDQDYGASTGRYLPGALANLQAKKYSAAIANLQDVVRASGDCENQFAGSSPLPVSQRNKAVHDI
ADMTTDIIKTFV*

DNA
ATGATTAACTTTATGAAATTATTCTCAATTTTCTTGTTCATCCAAATCCAAATAGCCTTGTCTCAACCAAATCTTATACA
ACAACTCTGCAAAAGAAACCGTTATCAACCCCTATGCGTCTCTACTCTCAATCTTGATCCTAGAAGCAAAACTTCAGATC
TTCAAGGGCTTGCGTCGATCTCTATCGATGCGACGACAAAGAAAACGAACGATACGTTAACTTATCTCATCTCCGAGTTA
CGGCGCACTGGAGGAGATCGCACAGCTTTTGAGAAGTACGGAACTTGCGTTGATCAGGATTACGGTGCGTCTACTGGTAG
GTATTTGCCGGGGGCTTTGGCTAATCTACAGGCTAAGAAGTACTCTGCTGCGATAGCTAACTTGCAAGACGTTGTGAGGG
CGTCAGGTGATTGTGAGAACCAGTTCGCCGGAAGTTCTCCATTACCGGTGAGCCAACGTAACAAAGCCGTTCATGATATT
GCCGATATGACTACTGACATCATCAAAACTTTTGTCTAG