Details for Chinese cabbage Locus Brara.A03009

Position : A01 ( 5`- 25576204 .. 25576758 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03009

Protein [Map View]
MEEAKGPVKHVLLAKFKDDVTQEKIDELIKGYANLIRGKDVSIENLHQGFTHIFESTFDSKEAVAEYVAHPLHVEFANMF
LGSLDKVLVIDYKPTSV*

DNA
ATGGAGGAAGCAAAGGGACCAGTGAAGCACGTTCTGCTTGCCAAGTTCAAAGATGACGTAACCCAAGAGAAGATCGATGA
ACTTATCAAAGGTTACGCTAATCTCATAAGGGGAAAAGATGTGAGCATAGAGAATCTGCATCAAGGTTTCACACATATTT
TTGAATCCACATTTGATAGCAAAGAAGCTGTAGCTGAGTACGTTGCTCATCCTCTTCACGTTGAGTTCGCCAACATGTTC
CTTGGCAGCTTGGATAAAGTGTTGGTTATAGACTACAAGCCTACCTCTGTTTAG