Details for Chinese cabbage Locus Brara.A03008

Position : A01 ( 5`- 25575378 .. 25576010 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03008

Protein [Map View]
MATTYIVNNVLVSCLMFFVMIGSSNAKPADIKVICGKAKNPSFCTNYMKSNPKISGADIKTLATITLGSAQTSASIALTK
IQSLATKETNPALKKGYTSCVEQYKNTISSLDEANTSLTSGDGPGLNIKVSAAMEGYTTCQDGLSNVKPDPSIVKDTGDF
QNVCGIILVISNMM*

DNA
ATGGCAACAACATACATTGTGAACAACGTTCTTGTATCTTGTTTGATGTTTTTTGTAATGATTGGTTCCTCAAACGCAAA
ACCTGCAGACATAAAAGTAATCTGCGGTAAAGCAAAAAACCCATCCTTCTGTACAAACTACATGAAATCAAACCCAAAGA
TTTCAGGTGCTGATATTAAAACGCTTGCAACGATCACCCTCGGCTCTGCACAAACAAGCGCATCAATAGCTTTGACGAAG
ATTCAGTCTCTTGCCACGAAAGAAACTAACCCTGCTTTGAAGAAAGGATACACCTCGTGCGTGGAGCAGTACAAGAATAC
AATCAGCAGTCTCGATGAAGCTAATACGAGCCTAACGTCAGGAGATGGTCCAGGGCTGAACATCAAGGTCTCAGCAGCTA
TGGAAGGTTATACAACATGTCAAGATGGCTTGTCGAACGTCAAACCTGATCCTTCAATTGTGAAGGACACAGGTGATTTT
CAGAATGTTTGTGGCATTATTCTTGTCATCTCCAACATGATGTGA