Details for Chinese cabbage Locus Brara.A03007

Position : A01 ( 5`- 25572626 .. 25574359 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03007

Protein [Map View]
MVMITDLPFDLEKKILARVPKVSRPQWQTTCKRWYAVRQDLLSKKHLARTGREFILLLNTNVFSTTINLQGVHNSVDPVM
EFGGKLGSLQDSDDLQIHDIFYCKGLVLCTMVGKQMLVVCNPSNRETRYVEPRTSHGCSEYALGYKGSKSSCVSSYKILR
YCRYSDKQLKRTVSEFELYDFMSDSWRVLDIDEHDWEITARGVSVKGNTYWVAKKKKDQFILSFDFSRERFGLLPLPYES
VGPEDFINNKYDDTAVLSVVRDEQLSVLHQYLHVYSSEMKIWVSNTIDTKKVSWSEFLVVDVVLLNIVSFVLEEEHKVAD
DPDDDGKEERTSISIIGKNIQSLVYDEGAIDGSWPHLMNYVPNPVQILRKGTRKSKRKRTTRRLFGKKR*

DNA
ATGGTGATGATAACCGACCTTCCATTTGATCTGGAAAAGAAGATACTCGCCCGTGTTCCGAAAGTGTCTCGACCACAATG
GCAAACTACTTGCAAGAGATGGTACGCTGTACGCCAAGATCTACTCTCCAAGAAACACTTGGCTCGAACAGGAAGAGAGT
TCATCTTATTGTTGAATACTAATGTTTTTTCAACAACCATCAACCTCCAGGGAGTCCATAACAGCGTTGATCCGGTGATG
GAGTTCGGAGGCAAACTTGGATCTTTACAAGATTCTGATGATTTACAAATCCATGATATTTTCTACTGCAAGGGGTTGGT
GCTATGCACTATGGTGGGAAAACAAATGCTCGTGGTTTGCAACCCTAGTAACCGTGAAACTAGGTATGTCGAACCTAGAA
CAAGTCATGGCTGTTCCGAATATGCTCTTGGATACAAAGGCAGCAAGTCTTCATGTGTTAGTAGCTACAAGATCTTGAGG
TATTGTCGTTATTCCGACAAGCAACTGAAGCGTACGGTTTCCGAGTTTGAACTGTATGACTTTATGTCTGACTCATGGAG
GGTTTTAGATATTGATGAGCACGATTGGGAAATAACGGCTCGTGGCGTCTCTGTGAAAGGAAACACTTACTGGGTTGCTA
AAAAGAAGAAGGACCAGTTCATACTCAGTTTTGATTTCAGTAGAGAGAGATTTGGGCTTCTCCCTCTTCCGTATGAGAGT
GTTGGCCCTGAAGATTTCATTAATAATAAGTATGACGATACAGCTGTTCTGTCAGTTGTTAGAGACGAACAACTCTCGGT
GTTACATCAATATCTTCATGTGTATTCATCAGAGATGAAGATATGGGTAAGCAATACAATTGACACCAAAAAGGTGTCGT
GGAGTGAGTTCTTGGTAGTGGACGTAGTGCTGTTAAATATTGTTAGTTTCGTCTTGGAAGAGGAGCATAAAGTGGCAGAT
GATCCTGATGATGATGGTAAAGAAGAGCGCACCAGCATTTCAATTATTGGAAAGAATATACAAAGTCTTGTTTATGATGA
AGGGGCTATAGATGGATCATGGCCTCATCTCATGAATTACGTTCCAAACCCGGTTCAAATTTTAAGGAAGGGTACGCGCA
AAAGCAAAAGGAAACGAACTACAAGGAGGTTATTCGGCAAGAAGCGTTGA