Details for Chinese cabbage Locus Brara.A03006

Position : A01 ( 5`- 25558401 .. 25559387 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A03006

Protein [Map View]
MPNLQGSLPPELANNVVRLYRECLRRATFIGKQQHNTELVVGMVRQQFKKHMNETDPEKIQKLKDDAARVLINHMLFESA
KLTGRKVGQRS*

DNA
ATGCCGAATCTACAAGGCTCTTTGCCTCCTGAGCTCGCTAACAATGTGGTTAGGTTGTACCGTGAATGTCTTCGTAGAGC
TACATTCATTGGTAAGCAGCAACACAACACTGAGCTGGTGGTTGGTATGGTGAGGCAGCAATTTAAAAAGCACATGAATG
AGACAGACCCCGAGAAGATTCAGAAGTTAAAGGATGATGCTGCTCGGGTACTCATCAATCACATGTTGTTCGAGTCAGCG
AAGCTAACAGGACGCAAGGTTGGCCAGAGATCGTGA