Details for Chinese cabbage Locus Brara.A02996

Position : A01 ( 5`- 25493485 .. 25494027 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02996

Protein [Map View]
MNPEQNPSRQCAACGEQEAFLTYAVRQNRRLCTDCLLKEHRHLFCPICLDVPPPPEESIVCLNCPSVAHLACPPPPPPPS
SSFTCPPCSDPNFSFFPKSNPDQESADALVAAAKISAALMNNEAAELKKEAHKKIFAAKEAKMRAKEALGNLQDLVLMQR
ASEKKNSNNANPNPNKRKHR*

DNA
ATGAATCCGGAGCAAAACCCCTCACGCCAATGCGCAGCCTGCGGGGAGCAAGAAGCCTTCCTCACCTACGCCGTCAGGCA
AAACCGGCGACTCTGCACCGACTGTTTACTCAAGGAGCATCGTCACCTCTTCTGCCCAATTTGTCTCGACGTCCCTCCTC
CTCCAGAAGAGAGCATCGTCTGCCTCAATTGCCCTTCCGTCGCCCACCTCGCTTGCCCTCCTCCTCCTCCTCCGCCGTCT
TCCTCCTTCACATGCCCGCCGTGCTCCGACCCCAATTTCTCCTTCTTCCCCAAATCTAACCCTGACCAAGAATCAGCCGA
CGCTCTCGTGGCAGCCGCCAAAATCTCGGCGGCTTTGATGAACAACGAGGCGGCTGAGTTAAAGAAGGAAGCTCATAAGA
AGATCTTCGCAGCCAAAGAGGCCAAGATGAGAGCTAAGGAAGCTTTGGGGAATCTTCAGGACCTTGTTCTCATGCAAAGA
GCTTCGGAGAAGAAGAATAGTAACAACGCTAACCCTAACCCTAACAAGAGGAAGCATCGTTGA