Details for Chinese cabbage Locus Brara.A02993

Position : A01 ( 5`- 25408744 .. 25410295 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02993

Protein [Map View]
MAAVPRGLISRFTQLLSIRSTTPSPSQPSFYLLRRFSSDAESPGSEAPTRIIPGEMSPGSKRTGIIAVKCGMTALWDKWG
ARVPVSILWVDDNIVSQVKTVEKEGIFALQIGCGHKKPKHLTMPELGHFRAQGVPLKRKLREFPVTEDALLPVGTELGVR
HFVPGQYVDVTGITRGKGFQGVMKRWKFKGGPASHGCSKAHRKGGSTGQRDDPGKVFKGRKMPGHMGAAQRTVKNVWVYK
IDPARNLIWVRGQVPGAEGNFVFINDACYKKPDISKLPFPTYLAPEEDEDPSELEPLVADLGEVDPFMLAE*

DNA
ATGGCGGCGGTACCGAGAGGCCTCATCTCTCGCTTCACTCAGCTTCTATCAATCCGGTCCACCACTCCTTCACCCTCACA
ACCTAGCTTCTATCTCCTCCGACGATTCAGCTCCGATGCTGAGTCGCCTGGATCCGAAGCTCCGACTCGGATAATACCCG
GAGAGATGTCTCCGGGATCGAAAAGAACAGGGATAATCGCCGTCAAGTGCGGGATGACTGCGCTCTGGGACAAATGGGGA
GCTAGGGTTCCGGTATCGATCCTCTGGGTGGACGACAACATCGTCTCTCAGGTCAAGACCGTTGAGAAAGAAGGGATCTT
TGCGCTACAGATTGGGTGTGGGCATAAGAAGCCGAAGCATTTGACGATGCCTGAGCTGGGTCATTTCAGAGCTCAAGGTG
TGCCGTTGAAGAGGAAGTTGAGGGAGTTCCCTGTGACGGAAGACGCGCTTCTTCCCGTTGGCACTGAGCTCGGTGTGCGT
CATTTTGTGCCGGGGCAGTATGTTGATGTCACTGGGATCACTCGTGGGAAAGGCTTTCAGGGAGTCATGAAAAGATGGAA
GTTCAAAGGAGGGCCGGCGTCACATGGTTGTTCAAAGGCGCATCGAAAAGGTGGTTCCACTGGCCAAAGAGATGATCCCG
GAAAGGTGTTCAAGGGAAGAAAAATGCCTGGGCACATGGGTGCGGCCCAGAGGACAGTAAAGAACGTTTGGGTTTACAAG
ATTGATCCTGCCAGGAACCTCATCTGGGTGAGAGGACAAGTTCCTGGCGCAGAAGGGAACTTTGTGTTTATTAACGATGC
GTGCTACAAGAAGCCAGACATCTCAAAGCTTCCATTCCCTACCTACTTAGCACCTGAAGAAGACGAGGATCCATCAGAAT
TAGAACCCTTGGTGGCAGATCTAGGAGAAGTCGACCCATTTATGTTGGCAGAGTGA