Details for Chinese cabbage Locus Brara.A02991

Position : A01 ( 5`- 25393913 .. 25394158 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02991

Protein [Map View]
MASWKKTIATPFKKAATLFNQPQQSPRKGCGGGKMDAKAREEHERRMVRELQGEVMACGYDDVLVMWSILDKSNSFSNLT
S*

DNA
ATGGCATCATGGAAGAAAACAATAGCAACACCATTCAAGAAGGCAGCAACACTCTTCAACCAACCGCAGCAATCGCCAAG
AAAGGGTTGCGGCGGTGGAAAAATGGATGCCAAAGCGAGGGAAGAGCACGAGAGGAGGATGGTAAGAGAGCTTCAAGGAG
AAGTCATGGCTTGTGGATACGACGATGTTCTCGTCATGTGGTCTATTCTTGACAAATCCAACTCCTTCAGTAACCTCACT
TCTTAA