Details for Chinese cabbage Locus Brara.A02990

Position : A01 ( 5`- 25385457 .. 25385857 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02990

Protein [Map View]
MEGVPIGRNLENLSHMFYTYFSYIIIYDNRDRKQHVLTYQEKDGDWMMVGDIPWDMFLETVRRLRITRLERC*

DNA
ATGGAAGGTGTCCCCATCGGAAGAAACCTTGAGAATCTCTCTCACATGTTCTATACATACTTCAGTTATATCATTATATA
CGATAACCGAGATAGGAAACAACATGTTTTGACGTATCAAGAGAAAGATGGAGATTGGATGATGGTAGGAGATATTCCAT
GGGATATGTTTCTTGAAACCGTAAGAAGACTAAGGATCACGAGACTAGAGAGGTGTTGA