Details for Chinese cabbage Locus Brara.A02988

Position : A01 ( 5`- 25381881 .. 25383504 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02988

Protein [Map View]
MANFGEGRRRGTGGMLPLLAISTVAEYYRLPWKPPVTAGLLAANTLVYLRPAFLDPLIPHISEVWFNPNLILKHKDLKRF
FLSALYHLNEPHLVYNMMSLLWKGIKLETSMGSTQFASMVVTLLGMSQGVTLLLAKSLHVLFDYRRAYYHEYSVGFSGVL
FALKVVLNAQAEDYTSVYGVLVPTKYAAWAELVLVQMFVPRASFLGHLGGILAGILYMKMKRSYLGSDPVAMVVRGVARA
VTWPLRFVSSMVGSRRRRITGRGRVGRGQNGIAGPGIWRCQSCTFDNSGWESVCEMCGSGRSRGNGWSVNQGQAHSSSSS
SDLPLDELRRRRVERFS*

DNA
ATGGCGAATTTTGGCGAAGGAAGAAGAAGAGGAACCGGAGGCATGCTCCCGCTTCTGGCGATTAGCACCGTCGCAGAATA
CTACAGACTGCCGTGGAAACCGCCTGTGACGGCAGGTCTATTAGCCGCGAACACTCTCGTCTATCTCAGGCCCGCGTTTC
TCGATCCCCTTATCCCTCACATCAGCGAGGTCTGGTTCAATCCAAACCTCATCCTCAAGCACAAGGACTTGAAACGCTTC
TTTCTATCAGCGTTGTACCATCTCAACGAGCCTCACCTAGTCTACAACATGATGTCTCTTCTCTGGAAAGGAATCAAGCT
GGAGACGTCCATGGGAAGCACACAGTTTGCTTCTATGGTCGTTACGCTTCTCGGTATGTCACAAGGAGTCACATTGCTGT
TAGCCAAGTCCCTGCATGTCTTATTTGACTACAGGAGAGCGTATTACCACGAGTACTCCGTGGGATTCTCGGGAGTACTC
TTTGCTTTGAAGGTTGTTCTCAATGCTCAGGCTGAGGATTACACCAGCGTGTACGGGGTCCTTGTCCCGACGAAGTATGC
TGCTTGGGCTGAGCTGGTTCTGGTGCAGATGTTTGTGCCGAGGGCTTCGTTTCTTGGGCATTTAGGTGGGATTCTTGCTG
GGATTCTTTACATGAAGATGAAGAGGTCTTACTTGGGGTCTGATCCTGTGGCTATGGTGGTTAGAGGTGTCGCTAGAGCG
GTGACGTGGCCGTTGAGGTTTGTGAGCAGTATGGTTGGGTCTCGTAGGAGGAGGATTACGGGGAGAGGAAGAGTGGGGAG
AGGACAGAATGGGATTGCAGGACCTGGTATCTGGAGATGCCAGTCGTGTACGTTTGACAATTCTGGTTGGGAGAGTGTTT
GTGAGATGTGTGGCTCGGGGAGGAGTAGAGGAAACGGATGGTCAGTGAACCAGGGACAGGCACATTCTTCATCTTCTTCT
AGTGATCTTCCTTTAGATGAGCTGCGGCGTCGGAGAGTAGAGAGGTTTAGTTAA