Details for Chinese cabbage Locus Brara.A02982

Position : A01 ( 5`- 25348888 .. 25350434 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02982

Protein [Map View]
MLKSEGSNHIVGDSSGWELYTNYTNRTQGREFHVGDVLVLNYNRDQHNVMQVNSTAYVYCGRDNYISLFNKGNDSIVISE
VGEHWFICAVDGHCENGPYLYWACIRIGPQVTNIEIQTYKVQTEISENGLLKSSLLSVA*

DNA
ATGCTAAAATCCGAAGGATCAAACCATATAGTTGGCGACAGCTCTGGTTGGGAACTTTACACAAACTATACCAACCGGAC
ACAGGGAAGAGAGTTTCATGTCGGCGATGTCTTAGTTCTCAACTACAATAGAGACCAGCATAATGTTATGCAAGTTAATT
CTACAGCCTACGTATACTGTGGAAGAGACAATTACATATCTCTCTTCAACAAAGGCAATGACTCAATAGTTATATCAGAG
GTTGGTGAGCACTGGTTCATCTGTGCAGTAGACGGCCACTGTGAGAATGGCCCATATCTCTATTGGGCCTGTATTAGAAT
TGGCCCTCAAGTCACCAACATTGAGATACAAACATACAAAGTACAAACCGAAATTTCTGAAAATGGATTGTTGAAGTCAT
CATTGTTGTCTGTTGCTTGA