Details for Chinese cabbage Locus Brara.A02976

Position : A01 ( 5`- 25302138 .. 25303774 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.A02976

Protein [Map View]
MDSRTTLISATAASLCFILCICMTNGQLQRFIEPAQSDGSVSFITIGDWGRRGDYNQSVVAYQMGRVGEKIGLDFVVSTG
DNFYDNGLYSEHDPNFKESFSNIYTAPSLQKQWYSVLGNHDYRGDAEAQLSSVLREIDSRWTCLRSFIVDAELVEIFFVD
TTPFVKEYYTEEDGHTYDWRAVPSRNSYVKYLLRDVEASLKRSKATWKIVVGHHAMRSIGHHGNTVELVEELLPIMKENG
VDLYMNGHDHCLEHISDEDSPIQFLTSGAGSKAWRGDVDPTTNNPKSVRFYYDGQGFMSARFTHSDAEIVFYNVFGEVLH
KWVTSKELLHSSV*

DNA
ATGGATTCTCGTACAACGTTAATATCCGCTACGGCGGCGAGCCTGTGTTTTATATTATGTATCTGCATGACGAACGGTCA
GCTTCAAAGATTCATTGAGCCGGCGCAGAGCGACGGTTCCGTTAGCTTTATAACCATCGGTGATTGGGGTCGCCGTGGCG
ACTACAATCAGTCTGTTGTGGCCTACCAGATGGGAAGGGTTGGAGAAAAGATTGGTTTAGATTTCGTGGTGTCCACGGGA
GATAACTTCTACGACAATGGATTGTATAGTGAACACGATCCTAACTTCAAAGAGTCTTTCTCTAACATCTACACTGCTCC
AAGTCTCCAGAAACAGTGGTACAGTGTCTTGGGGAACCATGACTATAGAGGTGACGCAGAAGCTCAGCTAAGCTCTGTTC
TCAGAGAAATCGACAGCCGCTGGACCTGTCTCCGTTCCTTCATCGTCGACGCAGAGTTGGTTGAGATCTTCTTCGTTGAC
ACCACTCCTTTCGTTAAAGAATACTACACAGAAGAAGATGGTCACACGTACGACTGGCGTGCGGTCCCGTCCCGAAACTC
TTATGTTAAGTATCTCCTCCGTGATGTCGAAGCTTCTTTGAAGAGATCTAAAGCCACGTGGAAGATTGTGGTTGGACACC
ACGCGATGAGAAGCATTGGTCACCATGGAAACACTGTTGAGCTAGTTGAAGAGCTTTTGCCGATTATGAAGGAGAACGGT
GTTGATCTTTACATGAATGGACATGACCATTGTCTTGAACATATCAGTGATGAAGACAGTCCTATTCAGTTTTTGACAAG
CGGTGCTGGCTCCAAGGCTTGGAGAGGAGATGTTGACCCGACTACCAACAATCCTAAGTCTGTGAGATTTTATTATGATG
GTCAAGGGTTCATGTCTGCTAGATTCACTCACTCAGATGCAGAGATTGTCTTCTACAATGTCTTTGGTGAGGTTTTGCAC
AAATGGGTTACTTCTAAGGAGCTTCTTCATTCCTCTGTTTGA